Sequence:
download
CE22119sequence.fasta
>EAT-2 MTLKIAFFTLILLVSIERVYSSDEEYRLLKDLREGYDPVERPVADHRKPVNVKLRLILQQLVDVDERNQVITLVVWNQYT WNDYKLRWSPEEYGNITTLQIPHGTLWKPDILLFNSANEHFDASFPVHMVVSSNGDVLFAPPGIVSFSCSLSMTWFPYDQ QVCYLKFGSWTYGKKLDLQIDDSDLPDGHKMDLQYYIPNGEFDLLATPAFRKSTTFLDETYVELYFHMHLKRRTMYYGLN WIVPSILISLSNILGFTMPPECGEKITLQITNFLSVMVFLAMVSEVAPPTSESIPIIAAFFSLSIVILGLSICASLIIVN IFFRHPKTHRMGDWTRYVFLEWLPWFLLMSRPEHTFCRPRREEEKNDEEAGGDGTKLLENQQHQPRPRLLVNSQLVMDST VPYLEEIIGYLKVFKAKLDDDEEEEEEILNWRFMAMVIDRLSLFLFTGLIFGTTALIFAFCPNLFTDSPIVDIE
view sequence (474 aa)
>EAT-2
MTLKIAFFTLILLVSIERVYSSDEEYRLLKDLREGYDPVERPVADHRKPVNVKLRLILQQLVDVDERNQVITLVVWNQYT
WNDYKLRWSPEEYGNITTLQIPHGTLWKPDILLFNSANEHFDASFPVHMVVSSNGDVLFAPPGIVSFSCSLSMTWFPYDQ
QVCYLKFGSWTYGKKLDLQIDDSDLPDGHKMDLQYYIPNGEFDLLATPAFRKSTTFLDETYVELYFHMHLKRRTMYYGLN
WIVPSILISLSNILGFTMPPECGEKITLQITNFLSVMVFLAMVSEVAPPTSESIPIIAAFFSLSIVILGLSICASLIIVN
IFFRHPKTHRMGDWTRYVFLEWLPWFLLMSRPEHTFCRPRREEEKNDEEAGGDGTKLLENQQHQPRPRLLVNSQLVMDST
VPYLEEIIGYLKVFKAKLDDDEEEEEEILNWRFMAMVIDRLSLFLFTGLIFGTTALIFAFCPNLFTDSPIVDIE
Estimated Isoelectric Point:
4.96166229248047
Estimated Molecular Weight:
55.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys19
Gln14
Leu59
Gly20
Met14
Ser31
Tyr18
His11
Glu33
Arg22
Cys6
Phe31
Pro28
Val32
Asn18
Ala17
Ile34
Trp11
Asp29