Sequence:
download
CE21681sequence.fasta
>ASP-1 MQTFVLLALVAACSAAVIQVPTHKTESLRAKLIKEGKYTAFLASQHAARAQQLNTGFQPFVDYFDDFYLGNITLGTPPQP ATVVLDTGSSNLWVIDAACKTQACNGYPDSGYTKQKFDTTKSTTFVKETRKFSIQYGSGSCNGYLGKDVLNFGGLTVQSQ EFGVSTHLADVFGYQPVDGILGLGWPALAVDQVVPPMQNLIAQKQLDAPLFTVWLDRNLQIAQGTPGGLITYGAIDTVNC AKQVTYVPLSAKTYWQFPLDAFAVGTYSETKKDQVISDTGTSWLGAPNTIVSAIVKQTKAVFDWSTELYTVDCSTMKTQP DLIFTIGGAQFPVKSVEYVLDLQLGGGKCALAVFSMGSGGFGPSWILGDTFIRQYCNVYDIGNGQIGFATAVHKGL
view sequence (396 aa)
>ASP-1
MQTFVLLALVAACSAAVIQVPTHKTESLRAKLIKEGKYTAFLASQHAARAQQLNTGFQPFVDYFDDFYLGNITLGTPPQP
ATVVLDTGSSNLWVIDAACKTQACNGYPDSGYTKQKFDTTKSTTFVKETRKFSIQYGSGSCNGYLGKDVLNFGGLTVQSQ
EFGVSTHLADVFGYQPVDGILGLGWPALAVDQVVPPMQNLIAQKQLDAPLFTVWLDRNLQIAQGTPGGLITYGAIDTVNC
AKQVTYVPLSAKTYWQFPLDAFAVGTYSETKKDQVISDTGTSWLGAPNTIVSAIVKQTKAVFDWSTELYTVDCSTMKTQP
DLIFTIGGAQFPVKSVEYVLDLQLGGGKCALAVFSMGSGGFGPSWILGDTFIRQYCNVYDIGNGQIGFATAVHKGL
Estimated Isoelectric Point:
5.81241607666016
Estimated Molecular Weight:
42.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr37
Lys22
Gln28
Leu35
Gly39
Met4
Ser23
Tyr16
His4
Glu7
Arg5
Cys8
Phe22
Pro18
Val33
Asn12
Ala34
Ile19
Trp7
Asp23