Sequence:
download
CE21562sequence.fasta
>CRT-1 MKSLCLLAIVAVVSAEVYFKEEFNDASWEKRWVQSKHKDDFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDF SNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICGPTRRVHVILNYKGENKLIKKEITCKS DELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDP DAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGT IFDNIIITDSVEEAEAHAAETFDKLKTVEKEKKEKADEETRKAEEEARKKAEEEKEAKKDDDEEEKEEEEGHDEL
view sequence (395 aa)
>CRT-1
MKSLCLLAIVAVVSAEVYFKEEFNDASWEKRWVQSKHKDDFGAFKLSAGKFFDVESRDQGIQTSQDAKFYSRAAKFDKDF
SNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLGDFHGETPYNVMFGPDICGPTRRVHVILNYKGENKLIKKEITCKS
DELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDWDLLPAKKIKDPDAKKPEDWDEREYIDDAEDAKPEDWEKPEHIPDP
DAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGT
IFDNIIITDSVEEAEAHAAETFDKLKTVEKEKKEKADEETRKAEEEARKKAEEEKEAKKDDDEEEKEEEEGHDEL
Estimated Isoelectric Point:
4.59198760986328
Estimated Molecular Weight:
45.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys49
Gln9
Leu19
Gly22
Met5
Ser17
Tyr14
His9
Glu56
Arg9
Cys4
Phe14
Pro19
Val17
Asn11
Ala28
Ile22
Trp11
Asp44