Sequence:
download
CE21418sequence.fasta
>PFN-1 MSGWNAYIDTMTAAAPSIKRCAIVGAADGSVWARTEADNVFKASEEELKTFVALFNDVTQVPAKGADIEGVHYVVPRTEE SLIFGKKENTGFFAVKTKSAVLIAVYEGPNEVAAQVRKAVESMQTYLNNAGY
view sequence (132 aa)
>PFN-1
MSGWNAYIDTMTAAAPSIKRCAIVGAADGSVWARTEADNVFKASEEELKTFVALFNDVTQVPAKGADIEGVHYVVPRTEE
SLIFGKKENTGFFAVKTKSAVLIAVYEGPNEVAAQVRKAVESMQTYLNNAGY
Estimated Isoelectric Point:
5.16727447509766
Estimated Molecular Weight:
14.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys9
Gln3
Leu5
Gly9
Met3
Ser7
Tyr5
His1
Glu11
Arg4
Cys1
Phe6
Pro4
Val15
Asn7
Ala20
Ile6
Trp2
Asp5