Sequence:
download
CE21092sequence.fasta
>DHS-15 MGRFSDKVAIITGSSSGIGRSTAVLLAQEGAKVTVTGRSSEKIQETVNEIHKNGGSSDNINIVLGDLNESECQDELIKST LSRFGKIDILINNAGAAFADPSGKIGSEAAIGIFDDMMKLNLRSVVELVKKCRPHLIASKGEIVNVSSIAAGPQPYIYYT YYGICKAGLDQLTRSLALELIPFDVRVNSVSPGLISTNFLGAVGMGDDVVKKTEEYYSTHRDCIPAGRTGKPEEIASLIA FLADRKSSAYIIGQSIVIDGGTTLVLGMPSHDLSKALA
view sequence (278 aa)
>DHS-15
MGRFSDKVAIITGSSSGIGRSTAVLLAQEGAKVTVTGRSSEKIQETVNEIHKNGGSSDNINIVLGDLNESECQDELIKST
LSRFGKIDILINNAGAAFADPSGKIGSEAAIGIFDDMMKLNLRSVVELVKKCRPHLIASKGEIVNVSSIAAGPQPYIYYT
YYGICKAGLDQLTRSLALELIPFDVRVNSVSPGLISTNFLGAVGMGDDVVKKTEEYYSTHRDCIPAGRTGKPEEIASLIA
FLADRKSSAYIIGQSIVIDGGTTLVLGMPSHDLSKALA
Estimated Isoelectric Point:
5.86304473876953
Estimated Molecular Weight:
29.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys17
Gln6
Leu24
Gly28
Met5
Ser29
Tyr8
His4
Glu15
Arg11
Cys4
Phe7
Pro9
Val19
Asn11
Ala23
Ile28
Asp16