Sequence:
download
CE20974sequence.fasta
>MOG-2 MVRLTTELFAERPQFVNSVNMREINLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIA PDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAAKK MFKGKSGKKARDAIQKSVHTEDPSEIEPNENSSGGGARLTDEDREKIKEAIKNAKSLSEVNYLQSILASGKVPEKGWNRQ MDQNGADGEAMES
view sequence (253 aa)
>MOG-2
MVRLTTELFAERPQFVNSVNMREINLRGQKIPVIENMGVTRDQFDVIDLTDNDIRKLDNFPTFSRLNTLYLHNNRINYIA
PDIATKLPNLKTLALTNNNICELGDIEPLAECKKLEYVTFIGNPITHKDNYRMYMIYKLPTVRVIDFNRVRLTEREAAKK
MFKGKSGKKARDAIQKSVHTEDPSEIEPNENSSGGGARLTDEDREKIKEAIKNAKSLSEVNYLQSILASGKVPEKGWNRQ
MDQNGADGEAMES
Estimated Isoelectric Point:
7.70191192626953
Estimated Molecular Weight:
28.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys21
Gln7
Leu21
Gly13
Met8
Ser12
Tyr7
His3
Glu21
Arg17
Cys2
Phe8
Pro11
Val13
Asn23
Ala15
Ile19
Trp1
Asp16