Sequence:
download
CE20656sequence.fasta
>GPC-2 MDKSDMQRTVDSLRSQLNIERTPITVSAAELRRFTESQEDPLVNPIDKKVNPWAEKSKCSML
view sequence (62 aa)
>GPC-2
MDKSDMQRTVDSLRSQLNIERTPITVSAAELRRFTESQEDPLVNPIDKKVNPWAEKSKCSML
Estimated Isoelectric Point:
6.17429351806641
Estimated Molecular Weight:
7.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys5
Gln3
Leu5
Met3
Ser7
Glu5
Arg5
Cys1
Phe1
Pro4
Val4
Asn3
Ala3
Ile3
Trp1
Asp5