Sequence:
download
CE20549sequence.fasta
>UNC-60 MASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGEKNAPYAEFVEEMKKLVEDGKECRYAAVDVEVTVQR QGAEGTSTLNKVIFVQYCPDNAPVRRRMLYASSVRALKASLGLESLFQVQASEMSDLDEKSVKSDLMSNQRI
view sequence (152 aa)
>UNC-60
MASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGEKNAPYAEFVEEMKKLVEDGKECRYAAVDVEVTVQR
QGAEGTSTLNKVIFVQYCPDNAPVRRRMLYASSVRALKASLGLESLFQVQASEMSDLDEKSVKSDLMSNQRI
Estimated Isoelectric Point:
6.30834197998047
Estimated Molecular Weight:
17.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys14
Gln7
Leu11
Gly6
Met5
Ser13
Tyr6
His3
Glu12
Arg7
Cys3
Phe4
Pro4
Val17
Asn7
Ala13
Ile6
Asp10