Sequence:
download
CE20534sequence.fasta
>NRX-1, isoform e MGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRS NDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
view sequence (137 aa)
>NRX-1, isoform e
MGDTITTTMQAATVTDFPRTPLIMCSSLAVIIAIAAVVFFVFKCRQNPPNSEHYTMAMKSQSGYTAIAPELSPPMNHDRS
NDSCTQPLLAKPHINGNGYEPLKGAVIANGNGATATMMRNGNGNGVAKKKDFKEWYV
Estimated Isoelectric Point:
8.84372711181641
Estimated Molecular Weight:
14.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys8
Gln4
Leu6
Gly10
Met8
Ser8
Tyr4
His3
Glu4
Arg4
Cys3
Phe5
Pro10
Val8
Asn11
Ala15
Ile8
Trp1
Asp5