Sequence:
download
CE20518sequence.fasta
>RAB-3, isoform b MAAGGQPQGATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAG QERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLE FFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQQQPKGQKLEANPTQKPAQQQCNC
view sequence (219 aa)
>RAB-3, isoform b
MAAGGQPQGATPGQPDQNFDYMFKLLIIGNSSVGKTSFLFRYCDDSFTSAFVSTVGIDFKVKTVFRGDKRVKLQIWDTAG
QERYRTITTAYYRGAMGFILMYDITNEESFNSVQDWCTQIKTYSWENAQVVLVGNKCDMDSERVVSMDRGRQLADQLGLE
FFETSAKENINVKAVFEKLVEIICDKMAESLDKDPQQQPKGQKLEANPTQKPAQQQCNC
Estimated Isoelectric Point:
5.17913055419922
Estimated Molecular Weight:
24.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys16
Gln19
Leu12
Gly15
Met7
Ser13
Tyr7
Glu12
Arg9
Cys6
Phe13
Pro7
Val15
Asn10
Ala14
Ile11
Trp3
Asp16