Sequence:
download
CE20390sequence.fasta
>EFL-1 MEDSYNDMEDPGFRQLSDMELQKALEMTKQSSIKNNLMLGLDNELDFDFDFDEDEDLDQPQMGTRADKSLGLLAKRFIRM IQYSPYGRCDLNTAAEALNVRQKRRIYDITNVLEGIGLIEKRSKNMIQWKGGDFMLNVKEGKRQSATTEEEDRMEQLKAE IEQLNKEEELIEQRQRWLQQSLRNMTESVENNKLSYVLRSQLAEIQGSDLTIGIQTRVGTQVRLSDPEQVEIHGGPSWCY LKDPSGPLRAAIVSNHELHDFVQRERAKRPGEEHVDADAPDEMMDDSRYRNRRTINDDEMFGFEQKVPAMKHLEPPPASD DYVYSSTGDEYRGDSIVDLYGD
view sequence (342 aa)
>EFL-1
MEDSYNDMEDPGFRQLSDMELQKALEMTKQSSIKNNLMLGLDNELDFDFDFDEDEDLDQPQMGTRADKSLGLLAKRFIRM
IQYSPYGRCDLNTAAEALNVRQKRRIYDITNVLEGIGLIEKRSKNMIQWKGGDFMLNVKEGKRQSATTEEEDRMEQLKAE
IEQLNKEEELIEQRQRWLQQSLRNMTESVENNKLSYVLRSQLAEIQGSDLTIGIQTRVGTQVRLSDPEQVEIHGGPSWCY
LKDPSGPLRAAIVSNHELHDFVQRERAKRPGEEHVDADAPDEMMDDSRYRNRRTINDDEMFGFEQKVPAMKHLEPPPASD
DYVYSSTGDEYRGDSIVDLYGD
Estimated Isoelectric Point:
4.65660858154297
Estimated Molecular Weight:
39.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys18
Gln22
Leu31
Gly21
Met15
Ser22
Tyr11
His5
Glu35
Arg26
Cys2
Phe9
Pro13
Val14
Asn16
Ala16
Ile17
Trp3
Asp34