Sequence:
download
CE20352sequence.fasta
>Y70G10A.3 MEKHDVHEFEEPDENLKHKIEDEDDAEKLLCGYGACTPSWLQGFHNAKCLLVVLGICAFIQSFVVNAIFPVGLSTLERRF KMTSTHTGIISSWYDFAVLLVVFPVCHWGNNGHKGRWIGWGGVIMALGSLICALPHWMVDIYHPDVNDLTNQTDFGQCAN RDDPECAGKPHSSWFNPYFWMFILGQTLHGVGSTPLFSIGTTYMDENVSQKASPVYLAIHAVLTSFGPVIGVFAGGFLLN LYDDFDRVERIPMERSDPRWVGAWWVGFIISSISALMIAFPILAFARELPEAKRHRAKDVNQCHVANGDVNAKAPRDLMK LPACVWKILSNPTFLVCIFVGIFESIIINGFAAFMPKILETLLSTNPTLASYLSSVVIFAAATGVMVGGTIIRQLKLQVG GMLKMIIVCHVFALLFTTGLLSHCPQREFVGINLGYEDLSIEKMHDFSISSTCNADCHCKMEWNPVCDRNTGHMYYSACH AGCTGRTTIDGSSQWSGCGCLTSNSTFHNLIHGIKEHPDVLNQGYCHQDCGYREYILMVTLFITVVASFASGIPTQQIML RVVPFDQRTLALGVNWTFVRLLGFIPGGILFGIIIDTACLEWGESCGKATSCLVYDPFKLSWTITGLAIVCKLLSILATI IGYMTYRPSDLDNAGSIQTVDSHCHTALHLVVNDDRLPEQAIIHASYAQM
view sequence (690 aa)
>Y70G10A.3
MEKHDVHEFEEPDENLKHKIEDEDDAEKLLCGYGACTPSWLQGFHNAKCLLVVLGICAFIQSFVVNAIFPVGLSTLERRF
KMTSTHTGIISSWYDFAVLLVVFPVCHWGNNGHKGRWIGWGGVIMALGSLICALPHWMVDIYHPDVNDLTNQTDFGQCAN
RDDPECAGKPHSSWFNPYFWMFILGQTLHGVGSTPLFSIGTTYMDENVSQKASPVYLAIHAVLTSFGPVIGVFAGGFLLN
LYDDFDRVERIPMERSDPRWVGAWWVGFIISSISALMIAFPILAFARELPEAKRHRAKDVNQCHVANGDVNAKAPRDLMK
LPACVWKILSNPTFLVCIFVGIFESIIINGFAAFMPKILETLLSTNPTLASYLSSVVIFAAATGVMVGGTIIRQLKLQVG
GMLKMIIVCHVFALLFTTGLLSHCPQREFVGINLGYEDLSIEKMHDFSISSTCNADCHCKMEWNPVCDRNTGHMYYSACH
AGCTGRTTIDGSSQWSGCGCLTSNSTFHNLIHGIKEHPDVLNQGYCHQDCGYREYILMVTLFITVVASFASGIPTQQIML
RVVPFDQRTLALGVNWTFVRLLGFIPGGILFGIIIDTACLEWGESCGKATSCLVYDPFKLSWTITGLAIVCKLLSILATI
IGYMTYRPSDLDNAGSIQTVDSHCHTALHLVVNDDRLPEQAIIHASYAQM
Estimated Isoelectric Point:
5.92958831787109
Estimated Molecular Weight:
76.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr40
Lys23
Gln19
Leu66
Gly56
Met20
Ser45
Tyr18
His28
Glu26
Arg22
Cys28
Phe38
Pro30
Val50
Asn27
Ala47
Ile55
Trp17
Asp35