Sequence:
download
CE19476sequence.fasta
>FRH-1 MLSTILRNNFVRRSFSSRIFSQNEYETAADSTLERLSDYFDQIADSFPVSEQFDVSHAMGVLTVNVSKSVGTYVINKQSP NKQIWLSSPMSGPKRYDLEEEGKWTYAHDGEQLDSLLNREFRKILADDRIDFSRHV
view sequence (136 aa)
>FRH-1
MLSTILRNNFVRRSFSSRIFSQNEYETAADSTLERLSDYFDQIADSFPVSEQFDVSHAMGVLTVNVSKSVGTYVINKQSP
NKQIWLSSPMSGPKRYDLEEEGKWTYAHDGEQLDSLLNREFRKILADDRIDFSRHV
Estimated Isoelectric Point:
5.33977508544922
Estimated Molecular Weight:
15.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys6
Gln6
Leu11
Gly5
Met3
Ser18
Tyr5
His3
Glu9
Arg10
Phe8
Pro4
Val9
Asn7
Ala6
Ile7
Trp2
Asp11