Sequence:
download
CE19370sequence.fasta
>C40A11.7 MCSSETIVKLNVGGSVFETWKSTLTKQDGFFKTLVETNIPVKKDTSDCYFIDRSPKYFETVLNYMRSGVTVLPDSEKELQ ELKKEAEFYLLEQLVDLCEPINNQIRTYRSSHELLQIIASTKKPVVVINYITHNNDIIYIPEGFRFDEFVKKNSSVVEIY FQPMDNREPLPKDLRRHRGMKYYPEPVWSYRIYNSTHSGCVDLTAMDDLQKKIDSILNGE
view sequence (220 aa)
>C40A11.7
MCSSETIVKLNVGGSVFETWKSTLTKQDGFFKTLVETNIPVKKDTSDCYFIDRSPKYFETVLNYMRSGVTVLPDSEKELQ
ELKKEAEFYLLEQLVDLCEPINNQIRTYRSSHELLQIIASTKKPVVVINYITHNNDIIYIPEGFRFDEFVKKNSSVVEIY
FQPMDNREPLPKDLRRHRGMKYYPEPVWSYRIYNSTHSGCVDLTAMDDLQKKIDSILNGE
Estimated Isoelectric Point:
5.66907501220703
Estimated Molecular Weight:
25.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys18
Gln7
Leu18
Gly8
Met5
Ser17
Tyr12
His4
Glu18
Arg10
Cys4
Phe10
Pro11
Val17
Asn12
Ala3
Ile16
Trp2
Asp14