Sequence:
download
CE18980sequence.fasta
>VHA-6 MGSIYRSEHMKLCQIFFQSESAYQCVAELGELGMAQFIDLNEEQNAYTRKFVNEVRRCDEMERKINFVEDEITKDLVPIP DYDEHIPAPQPKHMGEMEANLEKLEEELVQINKNCKVLKNNHVQLLEMKAVLEHVTSLLDPHSKREAAMSISEAARGEAG PISFGMKDEFDKPVKDEKELKFVTGVVKRSKAIAFERFLWRLSRAKVFAKFIQIQEQTELFSNEFEDKCVFILFFSGEQL RAKVKKICDGFQAKCYTVPENPAERTKLLLNIKVQTTDMKAVIEKTLDYRSKCIHAAATNLRKWGIMLLKLKSIFHTLNM FSVDVTQKCLIAECWVPEADIGQVKNSLHMGTIHSGSTVPAILNEMETDKYPPTYFKLNKFTQGFQNIVDAYGIANYREV NPAPWTIISFPFLFAVMFGDAGHGIIMLIAASAFVIFEKKLISMKIKDEIFNTFFGGRYVVLLMGMFAIYTGFIYNDFYS KSVNIFGSSWVNPYNQTLLANMDAQGADSNTDLSLTFPPEIAFNHDYGPYPFGVDPVWNLAINRLNFLNPMKMKTSILLG ISQMAFGIMLSLMNHIGNRSVVDIVFVFIPQCLFLGCIFVYLCLQVLMKWIFFYVKPAYIFGRLYPGSNCAPSLLIGLIN MFMVKSRDASFAHDVGTAAGKEWVIVNGQNVTYTINDQCYLQQWYPNQSLVELILLLIAVVSVPVMLLVKPFYIRWRHSR GLHIDLGHGPDEHGEFNFGDIMVHQAIHTIEFVLGCVSHTASYLRLWALSLAHAQLSDVLWTMVLRMSLTMGGWGGSAAI TILFYFIFSILSVCILILMEGLSAFLHAIRLHWVEFQSKFYGGTGIQFEPFCFTKIIRVYEGLDQ
view sequence (865 aa)
>VHA-6
MGSIYRSEHMKLCQIFFQSESAYQCVAELGELGMAQFIDLNEEQNAYTRKFVNEVRRCDEMERKINFVEDEITKDLVPIP
DYDEHIPAPQPKHMGEMEANLEKLEEELVQINKNCKVLKNNHVQLLEMKAVLEHVTSLLDPHSKREAAMSISEAARGEAG
PISFGMKDEFDKPVKDEKELKFVTGVVKRSKAIAFERFLWRLSRAKVFAKFIQIQEQTELFSNEFEDKCVFILFFSGEQL
RAKVKKICDGFQAKCYTVPENPAERTKLLLNIKVQTTDMKAVIEKTLDYRSKCIHAAATNLRKWGIMLLKLKSIFHTLNM
FSVDVTQKCLIAECWVPEADIGQVKNSLHMGTIHSGSTVPAILNEMETDKYPPTYFKLNKFTQGFQNIVDAYGIANYREV
NPAPWTIISFPFLFAVMFGDAGHGIIMLIAASAFVIFEKKLISMKIKDEIFNTFFGGRYVVLLMGMFAIYTGFIYNDFYS
KSVNIFGSSWVNPYNQTLLANMDAQGADSNTDLSLTFPPEIAFNHDYGPYPFGVDPVWNLAINRLNFLNPMKMKTSILLG
ISQMAFGIMLSLMNHIGNRSVVDIVFVFIPQCLFLGCIFVYLCLQVLMKWIFFYVKPAYIFGRLYPGSNCAPSLLIGLIN
MFMVKSRDASFAHDVGTAAGKEWVIVNGQNVTYTINDQCYLQQWYPNQSLVELILLLIAVVSVPVMLLVKPFYIRWRHSR
GLHIDLGHGPDEHGEFNFGDIMVHQAIHTIEFVLGCVSHTASYLRLWALSLAHAQLSDVLWTMVLRMSLTMGGWGGSAAI
TILFYFIFSILSVCILILMEGLSAFLHAIRLHWVEFQSKFYGGTGIQFEPFCFTKIIRVYEGLDQ
Estimated Isoelectric Point:
6.40596771240234
Estimated Molecular Weight:
98.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys52
Gln33
Leu85
Gly52
Met34
Ser49
Tyr29
His24
Glu52
Arg28
Cys18
Phe63
Pro33
Val61
Asn41
Ala57
Ile70
Trp14
Asp35