Sequence:
download
CE18787sequence.fasta
>END-3 MYSNSFSSSSSSSNSPMSFDFGFPQFPEQVQFNEEGYGTPSPDVLQNMNYHHYPAQDMTTNSYNGGYDNSMQQNFMQPDN GAGYYNENYQQMPDFQFPVQNFDFTNQFEFTTPINDLQQSQTSINHTNPDNNENSMPEIPIDGGFNFFPAQEVQEWKPAR KASKNKIKKISTMHINSSCSNCGCRETKLWRRNEQGETECNPCNLYERVKGHKRPQHLWNKPAAKRRRRPVAPLVDSNAF NF
view sequence (242 aa)
>END-3
MYSNSFSSSSSSSNSPMSFDFGFPQFPEQVQFNEEGYGTPSPDVLQNMNYHHYPAQDMTTNSYNGGYDNSMQQNFMQPDN
GAGYYNENYQQMPDFQFPVQNFDFTNQFEFTTPINDLQQSQTSINHTNPDNNENSMPEIPIDGGFNFFPAQEVQEWKPAR
KASKNKIKKISTMHINSSCSNCGCRETKLWRRNEQGETECNPCNLYERVKGHKRPQHLWNKPAAKRRRRPVAPLVDSNAF
NF
Estimated Isoelectric Point:
5.86710357666016
Estimated Molecular Weight:
27.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys11
Gln20
Leu6
Gly12
Met9
Ser23
Tyr10
His6
Glu14
Arg10
Cys5
Phe18
Pro20
Val7
Asn30
Ala9
Ile7
Trp3
Asp11