Sequence:
download
CE18526sequence.fasta
>TBX-38 MYSCTSPSGIKVSLSTPEIWEEFYPKTEMIVTRNRGRVIFPHLDYIIKGLDPGSLYSIYIHLERVDGIKYKFDAGEWKEF AKGDPILPIQYKEHPRGKRTGAEWMSEPVSFAHIKITNNPEIKDQKVILVQSMHKHIPVVTVKQVRHYKTGYQEDFSGEQ FRLEATEFMVVTAYQNEILKNLKVHHNKFASGFRSNGKRRLSSDSENSENSPPKRSKLVTPPTISPQIDLPQQTPYYFNQ NFVAPQNYQPQFASAQNYNFEVQNNAQLAWNMYYQKQYEFWWQQQQMMMPGQPQELKNEFQSL
view sequence (303 aa)
>TBX-38
MYSCTSPSGIKVSLSTPEIWEEFYPKTEMIVTRNRGRVIFPHLDYIIKGLDPGSLYSIYIHLERVDGIKYKFDAGEWKEF
AKGDPILPIQYKEHPRGKRTGAEWMSEPVSFAHIKITNNPEIKDQKVILVQSMHKHIPVVTVKQVRHYKTGYQEDFSGEQ
FRLEATEFMVVTAYQNEILKNLKVHHNKFASGFRSNGKRRLSSDSENSENSPPKRSKLVTPPTISPQIDLPQQTPYYFNQ
NFVAPQNYQPQFASAQNYNFEVQNNAQLAWNMYYQKQYEFWWQQQQMMMPGQPQELKNEFQSL
Estimated Isoelectric Point:
8.84351348876953
Estimated Molecular Weight:
35.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys23
Gln26
Leu16
Gly14
Met9
Ser22
Tyr17
His9
Glu22
Arg12
Cys1
Phe16
Pro22
Val17
Asn18
Ala12
Ile19
Trp6
Asp9