Sequence:
download
CE18491sequence.fasta
>NHR-67 MMTAVSQMSVPSSRILLDVDCRVCEDHSSGKHYSIFSCDGCAGFFKRSIRRHRQYVCKNKGSPSEGQCKVDKTHRNQCRA CRLRKCLEIGMNKDAVQHERGPRNSSLRRQQMMFDHGSSPNSPEMGSESDAIILPTSSMNRDTVAGTAARIFFALVGFCQ NPLNGVPKERQMTMFQQNWAALLVLHATETRAITSKQIRTETISGSSEQRNAVANAFEIIERLQLDNREYMMLKHFTMWR DTPSAIQIVFQLASIQNFTHRTEPTRYIQCINAIAAIPTTSIIDVLFRPSIGSASMPRLIQDMFKPPQQPTPTSLFPMAN FNLNFLLKQEKTETEEGEDIEEEDDATSSNQFDENSSTDDRSVGELDPVQLFLALNSSTQPSSASSPSSSRPRHSIRSIT ELLSIQEEESVNVEEV
view sequence (416 aa)
>NHR-67
MMTAVSQMSVPSSRILLDVDCRVCEDHSSGKHYSIFSCDGCAGFFKRSIRRHRQYVCKNKGSPSEGQCKVDKTHRNQCRA
CRLRKCLEIGMNKDAVQHERGPRNSSLRRQQMMFDHGSSPNSPEMGSESDAIILPTSSMNRDTVAGTAARIFFALVGFCQ
NPLNGVPKERQMTMFQQNWAALLVLHATETRAITSKQIRTETISGSSEQRNAVANAFEIIERLQLDNREYMMLKHFTMWR
DTPSAIQIVFQLASIQNFTHRTEPTRYIQCINAIAAIPTTSIIDVLFRPSIGSASMPRLIQDMFKPPQQPTPTSLFPMAN
FNLNFLLKQEKTETEEGEDIEEEDDATSSNQFDENSSTDDRSVGELDPVQLFLALNSSTQPSSASSPSSSRPRHSIRSIT
ELLSIQEEESVNVEEV
Estimated Isoelectric Point:
6.10283660888672
Estimated Molecular Weight:
46.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys14
Gln26
Leu27
Gly16
Met16
Ser49
Tyr4
His10
Glu30
Arg31
Cys11
Phe19
Pro22
Val19
Asn21
Ala26
Ile27
Trp2
Asp20