Sequence:
download
CE18470sequence.fasta
>HCP-1 MDESPIFDNENKRSAGNKRQQTESPFSAATPKSRLGREPKRIFGTSSGNMADSNLEETCLEHDSRPSSASSITPADNTSL LDLSTVTALATDDASFVGTNDASITPGSNVDVNLEQSELYDTSNCTSNLSMVQESDETDADATLSNDFDNQLALDGETTP TASRTPMSQILSRECTPTVSNPQLLTEIAKGVDQPTKPVRDVPQSPVLPVKGHIDFSLHEFEMLEQNSEHEESIKLLQSQ IELLRQSHSQQLSEIQEARIFEEKMLTQQVDSAMKKAKSDREAAKAREQVLEKQVQELRLKLEEPDEEKNQLVHNLAALN AQIEELTQKALKVDSMQQGATASEDRIRELIGGHQEAIKQLENTKQMNESLQRDLVEKEARFSEEMERIRTESQTTSESL KYEHELVRKMMIEDMEKLEAEVLALKSQQANLEIQEFHDKIKQLELEVQLSSENKEKLQAELMVVQEKASENIKNAEEKV NGLEAEVEKLRFEATNNSRVVELEQQLEEFRSLMIKEISDLENQLEAAKLESGSTSEPNAQLEASQATIQELTSEMKMQL EEVKRQSDENNSLNVHLTSSNEKIAELTSSLEMVAAQLLSSQQETDVAVTKVENLELKMEEAHRMYLLDIELSRVKIDEL QSSIEVLSKLEREVQSSNLQNEELKLSLRNFEELQADLAMSKAKNEELEQQIEDSSREFSVITEASKEMKLKWDSSEAQM SEMIASLAAFQEEMQSTQADAVASEDKVKQVESLLENLKEPLEELNNLRANLKDSNDKILDLQSQLELAQQSSDLADRLQ EDLRTSDARVQELNIQVSELEQQIEVSSREFSVITEANKEMQLKLDSSEAQISEMTASLTAFQEEMQSTRADAVASEDKV KELESLLENLKEPLEELNNLRANLKDSNGKVLELQSQLDLAQQFSDLTDRLQEDLRTSDARVQELNVQVSDLQSELETAR QDTNAVQVVMEALKSEQGESYEALRAELDAAVQEKGRSSDLVTSLEGKIQELETAIESSTAENVQKSKTIQDFTDKVSLL ESQICELKSQNEQMEIDTNLNMDQLSEMSSQLESANAELIELTRTSAETIDKLRGEVEKSTKAMMDQEEHLAELVAKIES RDVENADQAAKHKEEQERLQSVIDTLRTSQSTIEESQAKSEELNSRIKELQASIEFAQKALADTENAKQEKVEELEKVQE QMLNLVQAFEVEKASIRLEWNSSLSNANEKLEAAEEALSQKENTIVTLESRIETISQQFEARLEEANVWKSQAMQLGTLT QSLSQMQRQLGEMHEKMEASDRRVIEVEEQAQHDITLIQVENKEQSEALEQAHSRILELEEKLVRAEIEIQRLEKVCDAF DDDEREYKDKIMTLQSEIKQLKGVKTPPRVMGLIEQARLGVKQLSRESSLVEPQNSAHEDAFEDAQNSFQDRLQTMSNTT ARQIDASNHHPEDHVLEKSARETPSKKNRSNCQHQ
view sequence (1475 aa)
>HCP-1
MDESPIFDNENKRSAGNKRQQTESPFSAATPKSRLGREPKRIFGTSSGNMADSNLEETCLEHDSRPSSASSITPADNTSL
LDLSTVTALATDDASFVGTNDASITPGSNVDVNLEQSELYDTSNCTSNLSMVQESDETDADATLSNDFDNQLALDGETTP
TASRTPMSQILSRECTPTVSNPQLLTEIAKGVDQPTKPVRDVPQSPVLPVKGHIDFSLHEFEMLEQNSEHEESIKLLQSQ
IELLRQSHSQQLSEIQEARIFEEKMLTQQVDSAMKKAKSDREAAKAREQVLEKQVQELRLKLEEPDEEKNQLVHNLAALN
AQIEELTQKALKVDSMQQGATASEDRIRELIGGHQEAIKQLENTKQMNESLQRDLVEKEARFSEEMERIRTESQTTSESL
KYEHELVRKMMIEDMEKLEAEVLALKSQQANLEIQEFHDKIKQLELEVQLSSENKEKLQAELMVVQEKASENIKNAEEKV
NGLEAEVEKLRFEATNNSRVVELEQQLEEFRSLMIKEISDLENQLEAAKLESGSTSEPNAQLEASQATIQELTSEMKMQL
EEVKRQSDENNSLNVHLTSSNEKIAELTSSLEMVAAQLLSSQQETDVAVTKVENLELKMEEAHRMYLLDIELSRVKIDEL
QSSIEVLSKLEREVQSSNLQNEELKLSLRNFEELQADLAMSKAKNEELEQQIEDSSREFSVITEASKEMKLKWDSSEAQM
SEMIASLAAFQEEMQSTQADAVASEDKVKQVESLLENLKEPLEELNNLRANLKDSNDKILDLQSQLELAQQSSDLADRLQ
EDLRTSDARVQELNIQVSELEQQIEVSSREFSVITEANKEMQLKLDSSEAQISEMTASLTAFQEEMQSTRADAVASEDKV
KELESLLENLKEPLEELNNLRANLKDSNGKVLELQSQLDLAQQFSDLTDRLQEDLRTSDARVQELNVQVSDLQSELETAR
QDTNAVQVVMEALKSEQGESYEALRAELDAAVQEKGRSSDLVTSLEGKIQELETAIESSTAENVQKSKTIQDFTDKVSLL
ESQICELKSQNEQMEIDTNLNMDQLSEMSSQLESANAELIELTRTSAETIDKLRGEVEKSTKAMMDQEEHLAELVAKIES
RDVENADQAAKHKEEQERLQSVIDTLRTSQSTIEESQAKSEELNSRIKELQASIEFAQKALADTENAKQEKVEELEKVQE
QMLNLVQAFEVEKASIRLEWNSSLSNANEKLEAAEEALSQKENTIVTLESRIETISQQFEARLEEANVWKSQAMQLGTLT
QSLSQMQRQLGEMHEKMEASDRRVIEVEEQAQHDITLIQVENKEQSEALEQAHSRILELEEKLVRAEIEIQRLEKVCDAF
DDDEREYKDKIMTLQSEIKQLKGVKTPPRVMGLIEQARLGVKQLSRESSLVEPQNSAHEDAFEDAQNSFQDRLQTMSNTT
ARQIDASNHHPEDHVLEKSARETPSKKNRSNCQHQ
Estimated Isoelectric Point:
4.52993011474609
Estimated Molecular Weight:
166.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr75
Lys96
Gln131
Leu169
Gly24
Met42
Ser155
Tyr5
His21
Glu224
Arg66
Cys6
Phe25
Pro25
Val76
Asn73
Ala118
Ile61
Trp3
Asp80