Sequence:
download
CE18424sequence.fasta
>UNC-52, isoform e MKRSSTVLAALLALLLVATNDAARHRKYRQTYQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR WARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNE CVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQC HDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQ TSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTC ECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSF FKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSP VRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGY LGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIP CFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGD KVTSYGGTLEYTFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLAD LDTLLIKSTYNDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGH ASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCE RCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDI TFVQKPHEVLRVRIMEPKRQIALPGDRVHWICQVTGYTTEKIHVEWTKVGEMSLPPNAKAYDGYLVLKGVEAENAGQYRC TATTITQYATDDALLTISKRISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALK IPQSQLHHAGRYICSAANQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPS GVQEQQGILHIPRASDQEVGQYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQ PRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEG EPSRIRCWVPGHPNIQLQFVKRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPI IDPAEQTVPEGSPFKIRCYVPGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPAT VHVTNAAAPPQVEARPPQHPVITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQ DAGEYVCLYSPENSPPVKTNPSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVN QDGDDIVISEAGDRNVGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWT GPNGSPLPHDVTPLEPNILDFSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEA FGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVS ILGGSSQWFDQGEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAA VHVHSSANADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVY RCNVEDNNGLVIGSAFTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFD DASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQV TGGRLLFTDLKEDNAGVYRCVAKTKAGPLQTRTVLNVGSGKQDQVTFTVADSLPVVYTVGQPAYLSCIGKTETKPNQSVV WTKEEGDLPSGSRVEQGVLMLPSVHRDDEGSYTCEIVKEENPVFSTVDLQIDDFIPVIDGEPIELPPLSDEEIVNLDIEI TLNTANPKGIIFETKRINSGDLLATPYDTIHHEAKITDYGTVLYEFDIGNGRQIVETTNPINPNEWNVIKIKNDKNQVTI QLNDESATIRQHTNPLPSLSTGVNRPVFIGGRHEPTNEANDFRGIISQVVLSGHNVGLGDARIPSSVVKYDACASTNLCL NGANCRNANNHHGFSCECAEEFHGEYCQWRSNSCHDESCNTGICLDNEESWQCVCPLGTTGLRCEEKTEIPQPLGFTSDT SFLAVKRPVKFESIKMKLRPQADSDEHILMYFASDYGSNTKQYTSLSLIANQVVLTVRRPDKEVQKIRSETLEAGELIDV AVRQAGNALVMTVDGNQVSTIETDTLKPGTEIFIGGLPPGLNSPDDVVEQSFQGCVYEILINSQDVDLQNLSSSGDISSC EESQFPVEEDDTTTTTTTEEPEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEPTTTTEEPTTTTTEEPYHIYE TSRDDDPEIIIPVETTTTSTTTTSTTEEPEAEPALVLPTDPVEENDVSDEEEEISTISTVSPDNGLDSDSDYSEGTLPPD SSSEEIVVGDVYSTQEPNNICANSTCGMNGQCVPRNMTHYTCECKLYYDGPTCSLFKPIEHAARFDGDAFIELSSDEFPH LTSEKDEIVAFKFKTEQQNGVLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHLISEERVDDGKEHSVRFERKG REGQMRIDNYREVDGRSTGILAMLNVDGNIFVGGVPDISKATGGLFSNNFVGCIADVELNGVKLDLMATAIDGKNVKPCD EWMHRKRWLYRRRVR
view sequence (3375 aa)
>UNC-52, isoform e
MKRSSTVLAALLALLLVATNDAARHRKYRQTYQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR
WARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNE
CVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQC
HDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQ
TSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTC
ECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSF
FKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSP
VRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGY
LGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIP
CFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGD
KVTSYGGTLEYTFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLAD
LDTLLIKSTYNDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGH
ASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCE
RCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDI
TFVQKPHEVLRVRIMEPKRQIALPGDRVHWICQVTGYTTEKIHVEWTKVGEMSLPPNAKAYDGYLVLKGVEAENAGQYRC
TATTITQYATDDALLTISKRISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALK
IPQSQLHHAGRYICSAANQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPS
GVQEQQGILHIPRASDQEVGQYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQ
PRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEG
EPSRIRCWVPGHPNIQLQFVKRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPI
IDPAEQTVPEGSPFKIRCYVPGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPAT
VHVTNAAAPPQVEARPPQHPVITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQ
DAGEYVCLYSPENSPPVKTNPSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVN
QDGDDIVISEAGDRNVGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWT
GPNGSPLPHDVTPLEPNILDFSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEA
FGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVS
ILGGSSQWFDQGEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAA
VHVHSSANADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVY
RCNVEDNNGLVIGSAFTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFD
DASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQV
TGGRLLFTDLKEDNAGVYRCVAKTKAGPLQTRTVLNVGSGKQDQVTFTVADSLPVVYTVGQPAYLSCIGKTETKPNQSVV
WTKEEGDLPSGSRVEQGVLMLPSVHRDDEGSYTCEIVKEENPVFSTVDLQIDDFIPVIDGEPIELPPLSDEEIVNLDIEI
TLNTANPKGIIFETKRINSGDLLATPYDTIHHEAKITDYGTVLYEFDIGNGRQIVETTNPINPNEWNVIKIKNDKNQVTI
QLNDESATIRQHTNPLPSLSTGVNRPVFIGGRHEPTNEANDFRGIISQVVLSGHNVGLGDARIPSSVVKYDACASTNLCL
NGANCRNANNHHGFSCECAEEFHGEYCQWRSNSCHDESCNTGICLDNEESWQCVCPLGTTGLRCEEKTEIPQPLGFTSDT
SFLAVKRPVKFESIKMKLRPQADSDEHILMYFASDYGSNTKQYTSLSLIANQVVLTVRRPDKEVQKIRSETLEAGELIDV
AVRQAGNALVMTVDGNQVSTIETDTLKPGTEIFIGGLPPGLNSPDDVVEQSFQGCVYEILINSQDVDLQNLSSSGDISSC
EESQFPVEEDDTTTTTTTEEPEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEPTTTTEEPTTTTTEEPYHIYE
TSRDDDPEIIIPVETTTTSTTTTSTTEEPEAEPALVLPTDPVEENDVSDEEEEISTISTVSPDNGLDSDSDYSEGTLPPD
SSSEEIVVGDVYSTQEPNNICANSTCGMNGQCVPRNMTHYTCECKLYYDGPTCSLFKPIEHAARFDGDAFIELSSDEFPH
LTSEKDEIVAFKFKTEQQNGVLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHLISEERVDDGKEHSVRFERKG
REGQMRIDNYREVDGRSTGILAMLNVDGNIFVGGVPDISKATGGLFSNNFVGCIADVELNGVKLDLMATAIDGKNVKPCD
EWMHRKRWLYRRRVR
Estimated Isoelectric Point:
4.76374053955078
Estimated Molecular Weight:
369.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr257
Lys120
Gln161
Leu204
Gly267
Met22
Ser224
Tyr93
His73
Glu250
Arg173
Cys131
Phe89
Pro273
Val249
Asn167
Ala198
Ile159
Trp34
Asp231