Sequence:
download
CE18125sequence.fasta
>PDCD-2 MQTDIHDEPVNLGFGVQFEPDDLYRLRSQFLPLGKIGGKPSWLNPKNLPKSADLLCNVCEKPLCFLMQVSANGGINDPPH AFHRSLFLFVCRNPSCSRTNDAANLKAFRCQLPRANDYYSFDGPMDPDLDGDVADPRAPADGPGLCRICGCSAAKKCAKC QVARYCSQAHQVIDWPAHKLECAKAATDGSITDEPKNPRNAFCFKEFGVEIDQEYMPANLFDGLSDDEGDEEEEEGNDED ETEEEKKARIREFEKFVKENKGKNADMTKEDLDEATAEQPKDIDFDKFNRLVNLQPDQIIRYKRYGQPLRATGLSELPEV VEPCELCGAPRRFEMQLMPHLLSLIDVDAIGQSIDWASVYVYTCSASCQIADDGYAKEFVAKQDFL
view sequence (386 aa)
>PDCD-2
MQTDIHDEPVNLGFGVQFEPDDLYRLRSQFLPLGKIGGKPSWLNPKNLPKSADLLCNVCEKPLCFLMQVSANGGINDPPH
AFHRSLFLFVCRNPSCSRTNDAANLKAFRCQLPRANDYYSFDGPMDPDLDGDVADPRAPADGPGLCRICGCSAAKKCAKC
QVARYCSQAHQVIDWPAHKLECAKAATDGSITDEPKNPRNAFCFKEFGVEIDQEYMPANLFDGLSDDEGDEEEEEGNDED
ETEEEKKARIREFEKFVKENKGKNADMTKEDLDEATAEQPKDIDFDKFNRLVNLQPDQIIRYKRYGQPLRATGLSELPEV
VEPCELCGAPRRFEMQLMPHLLSLIDVDAIGQSIDWASVYVYTCSASCQIADDGYAKEFVAKQDFL
Estimated Isoelectric Point:
4.66333770751953
Estimated Molecular Weight:
43.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys25
Gln17
Leu32
Gly23
Met7
Ser18
Tyr10
His6
Glu31
Arg19
Cys18
Phe20
Pro27
Val17
Asn18
Ala33
Ile15
Trp3
Asp38