Sequence:
download
CE18112sequence.fasta
>IMB-2, isoform b MAFQPDQHELEQLLRCSLDGNKKVQEAACSAFATLEEEAGEQLIPFLGEILDQLVKAFQCYQAKNLLILYDAIGTLANSV GDALSHPVYVQMLMPPLMEKWERLSDEDKELFPLLECISAIVSAMGQSFLPYIQPVFTRCCSLIEKCVQQNQQHIMAPDQ VEAPETDFIIVALDLLSGLAESLPEHMDPLVANSKLVELMLFCSLDVTPDVRQSCFALLGDLTKACPERVLPQSSNFIFF LAQNLDPSKISVCNNAIWALGELALKMGPAMKQFIGPIIEPLIVVINSQQNMQRTLLENTAITIGRLGQCCGEELAPHIS RFVRPCCYSLRNIKDNAEKESAFIGLCNMINMNPVGVLNDFIFWCDAIASWTVPTDSLRVLFAGILQSFKQQVGDFNWNN FILQLPPPLRERLSAFYQI
view sequence (419 aa)
>IMB-2, isoform b
MAFQPDQHELEQLLRCSLDGNKKVQEAACSAFATLEEEAGEQLIPFLGEILDQLVKAFQCYQAKNLLILYDAIGTLANSV
GDALSHPVYVQMLMPPLMEKWERLSDEDKELFPLLECISAIVSAMGQSFLPYIQPVFTRCCSLIEKCVQQNQQHIMAPDQ
VEAPETDFIIVALDLLSGLAESLPEHMDPLVANSKLVELMLFCSLDVTPDVRQSCFALLGDLTKACPERVLPQSSNFIFF
LAQNLDPSKISVCNNAIWALGELALKMGPAMKQFIGPIIEPLIVVINSQQNMQRTLLENTAITIGRLGQCCGEELAPHIS
RFVRPCCYSLRNIKDNAEKESAFIGLCNMINMNPVGVLNDFIFWCDAIASWTVPTDSLRVLFAGILQSFKQQVGDFNWNN
FILQLPPPLRERLSAFYQI
Estimated Isoelectric Point:
4.63684844970703
Estimated Molecular Weight:
46.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys15
Gln29
Leu56
Gly18
Met13
Ser26
Tyr6
His5
Glu28
Arg13
Cys17
Phe23
Pro26
Val24
Asn21
Ala33
Ile30
Trp5
Asp20