Sequence:
download
CE18111sequence.fasta
>IMB-2, isoform a MAFQPDQHELEQVIQLLQHAHSTDRDVQRNVQVQLVQLNEHQKFCCYLVYILSDMKEMIDATSRSLAGLLLKNNIRAKWN KYPQDVKFFVRTTCLKSIGDQEPLIRATVGIIVTTIVMEENMCDWPDLLDTLATVLMQPDELMQEGALGALQKVFEDSAD RYESEFLRPIMPKLLVFYEHHAAKMRALAMNCVNCILMVNNDPIDFAIDQFLTSLFARHNDNDEEVQKQLCRSLTLLLDT HIEKMMPHLPNVIEYIIKKTQDHNESIALEACEFWLSIAENSDICRTMVLPHLDKLIPVLLGSMRYSETDPALKANDEDS SVPDREEDIKPRFHKSKQHGLGGLVESDDEEDEDDDDDGGGDWNIRRCSAASLDVLASIFGKDLLDKLFPLLKDTLMNDN WLVKESGILALGAIAEGCMDGVVPHLGELIPFMLAMMFDKKPLVRSITCWTLSRYSSHIASDENFRQQFFKDVLANLLRC SLDGNKKVQEAACSAFATLEEEAGEQLIPFLGEILDQLVKAFQCYQAKNLLILYDAIGTLANSVGDALSHPVYVQMLMPP LMEKWERLSDEDKELFPLLECISAIVSAMGQSFLPYIQPVFTRCCSLIEKCVQQNQQHIMAPDQVEAPETDFIIVALDLL SGLAESLPEHMDPLVANSKLVELMLFCSLDVTPDVRQSCFALLGDLTKACPERVLPQSSNFIFFLAQNLDPSKISVCNNA IWALGELALKMGPAMKQFIGPIIEPLIVVINSQQNMQRTLLENTAITIGRLGQCCGEELAPHISRFVRPCCYSLRNIKDN AEKESAFIGLCNMINMNPVGVLNDFIFWCDAIASWTVPTDSLRVLFAGILQSFKQQVGDFNWNNFILQLPPPLRERLSAF YQI
view sequence (883 aa)
>IMB-2, isoform a
MAFQPDQHELEQVIQLLQHAHSTDRDVQRNVQVQLVQLNEHQKFCCYLVYILSDMKEMIDATSRSLAGLLLKNNIRAKWN
KYPQDVKFFVRTTCLKSIGDQEPLIRATVGIIVTTIVMEENMCDWPDLLDTLATVLMQPDELMQEGALGALQKVFEDSAD
RYESEFLRPIMPKLLVFYEHHAAKMRALAMNCVNCILMVNNDPIDFAIDQFLTSLFARHNDNDEEVQKQLCRSLTLLLDT
HIEKMMPHLPNVIEYIIKKTQDHNESIALEACEFWLSIAENSDICRTMVLPHLDKLIPVLLGSMRYSETDPALKANDEDS
SVPDREEDIKPRFHKSKQHGLGGLVESDDEEDEDDDDDGGGDWNIRRCSAASLDVLASIFGKDLLDKLFPLLKDTLMNDN
WLVKESGILALGAIAEGCMDGVVPHLGELIPFMLAMMFDKKPLVRSITCWTLSRYSSHIASDENFRQQFFKDVLANLLRC
SLDGNKKVQEAACSAFATLEEEAGEQLIPFLGEILDQLVKAFQCYQAKNLLILYDAIGTLANSVGDALSHPVYVQMLMPP
LMEKWERLSDEDKELFPLLECISAIVSAMGQSFLPYIQPVFTRCCSLIEKCVQQNQQHIMAPDQVEAPETDFIIVALDLL
SGLAESLPEHMDPLVANSKLVELMLFCSLDVTPDVRQSCFALLGDLTKACPERVLPQSSNFIFFLAQNLDPSKISVCNNA
IWALGELALKMGPAMKQFIGPIIEPLIVVINSQQNMQRTLLENTAITIGRLGQCCGEELAPHISRFVRPCCYSLRNIKDN
AEKESAFIGLCNMINMNPVGVLNDFIFWCDAIASWTVPTDSLRVLFAGILQSFKQQVGDFNWNNFILQLPPPLRERLSAF
YQI
Estimated Isoelectric Point:
4.73757171630859
Estimated Molecular Weight:
99.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys41
Gln48
Leu115
Gly36
Met32
Ser53
Tyr14
His19
Glu59
Arg33
Cys29
Phe41
Pro44
Val52
Asn42
Ala62
Ile59
Trp11
Asp64