Sequence:
download
CE17952sequence.fasta
>SRH-248 MNCYNANSYYASPEFLIRVSNVITFFEVPLCIFGAYCILFKTPEKMKSVKWLMMNLHFWSFLSDLTICCFGIPFLHLPHN AGYGLGLIDAPGLMIYCGITFMGAFGVTILAIYENRYYIVFAQNSIWKQLRRIFMPLMWILVPFYFLPPFFQIPDQESAR IHIQKEIPCLNLTLVNNRNLFVLSLNSNLVGYCAIMETVVIVSPIILFFFLTLYQFFKIRDSMKFSSKSYQLQKSFLIAI TLQSLLSFVFILVPVTIVLYGFVFWYYNQVLNNFMSIMFSLFGLETCVVMILVHRPYREYALSLLLFFRKRTVKKVDCIS VVMIH
view sequence (325 aa)
>SRH-248
MNCYNANSYYASPEFLIRVSNVITFFEVPLCIFGAYCILFKTPEKMKSVKWLMMNLHFWSFLSDLTICCFGIPFLHLPHN
AGYGLGLIDAPGLMIYCGITFMGAFGVTILAIYENRYYIVFAQNSIWKQLRRIFMPLMWILVPFYFLPPFFQIPDQESAR
IHIQKEIPCLNLTLVNNRNLFVLSLNSNLVGYCAIMETVVIVSPIILFFFLTLYQFFKIRDSMKFSSKSYQLQKSFLIAI
TLQSLLSFVFILVPVTIVLYGFVFWYYNQVLNNFMSIMFSLFGLETCVVMILVHRPYREYALSLLLFFRKRTVKKVDCIS
VVMIH
Estimated Isoelectric Point:
9.09687042236328
Estimated Molecular Weight:
38.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys13
Gln10
Leu42
Gly12
Met14
Ser22
Tyr18
His6
Glu9
Arg11
Cys10
Phe34
Pro15
Val26
Asn17
Ala12
Ile32
Trp5
Asp5