Sequence:
download
CE16893sequence.fasta
>TTC-1 MAIIEEIFEDEEDQITKVDSLKKEGNNFFANGEFEKANEKYQEAIASCPPTSTEVQSILLSNSAAALIKLRKWESAVEAA SKSIEIGATNEKALERRAFAYSNMSEKYENSIEDYKQLQESLPKRRVELDRKIAEINEKINNRNEAMKADVMEKLKGFGN FCLSPFGLSTDSFEMVPNGNGGFSVQMKGATNKQEGASQEKKEEENA
view sequence (207 aa)
>TTC-1
MAIIEEIFEDEEDQITKVDSLKKEGNNFFANGEFEKANEKYQEAIASCPPTSTEVQSILLSNSAAALIKLRKWESAVEAA
SKSIEIGATNEKALERRAFAYSNMSEKYENSIEDYKQLQESLPKRRVELDRKIAEINEKINNRNEAMKADVMEKLKGFGN
FCLSPFGLSTDSFEMVPNGNGGFSVQMKGATNKQEGASQEKKEEENA
Estimated Isoelectric Point:
4.83946990966797
Estimated Molecular Weight:
23.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys21
Gln8
Leu12
Gly11
Met6
Ser18
Tyr4
Glu31
Arg7
Cys2
Phe10
Pro5
Val7
Asn17
Ala21
Ile13
Trp1
Asp7