Sequence:
download
CE16833sequence.fasta
>CED-10, isoform b MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLV CFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSAL TQRGLKQVFDEAIRAVLTPPQRAKKSKCTVL
view sequence (191 aa)
>CED-10, isoform b
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLV
CFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSAL
TQRGLKQVFDEAIRAVLTPPQRAKKSKCTVL
Estimated Isoelectric Point:
8.50257110595703
Estimated Molecular Weight:
21.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys11
Gln9
Leu17
Gly10
Met3
Ser8
Tyr8
His2
Glu10
Arg13
Cys6
Phe6
Pro12
Val19
Asn8
Ala15
Ile8
Trp2
Asp11