Sequence:
download
CE16832sequence.fasta
>CED-10, isoform a MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRERRLQPVSQTQG YVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPPQRAKKSKCTVL
view sequence (129 aa)
>CED-10, isoform a
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRERRLQPVSQTQG
YVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPPQRAKKSKCTVL
Estimated Isoelectric Point:
8.92778778076172
Estimated Molecular Weight:
14.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys9
Gln8
Leu11
Gly9
Met3
Ser5
Tyr6
Glu6
Arg8
Cys4
Phe3
Pro6
Val13
Asn4
Ala11
Ile6
Trp1
Asp7