Sequence:
download
CE16790sequence.fasta
>UNC-5, isoform a MDEITITTQPKSGYVIRNKPLRLQCRANHATKIRYKCSSKWIDDSRIEKLIGTDSTSGVGYIDASVDISRIDVDTSGHVD AFQCQCYASGDDDQDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIR ASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQR RTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQEC PAQLCTADSSRIVISDTAVYGSVASIFIVASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPPGVRRLLLE HQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTRNAGSRAALIQECSSSSSGSGGKRTMLRTSSSNCSDDD NYATLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPELAVEGEKMLYLAVSDTLTDQPHLKPIESALSP VIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFG WCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVFGPTEMSAYRRPFELRVYCVPETGAAMESVWKQEDGSRLLCESNDFI LNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVSNE PELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASS SGSARAVPDLLQTLRVMGRPDAVMVLERFLSAFPQIVSP
view sequence (919 aa)
>UNC-5, isoform a
MDEITITTQPKSGYVIRNKPLRLQCRANHATKIRYKCSSKWIDDSRIEKLIGTDSTSGVGYIDASVDISRIDVDTSGHVD
AFQCQCYASGDDDQDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIR
ASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQR
RTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQEC
PAQLCTADSSRIVISDTAVYGSVASIFIVASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPPGVRRLLLE
HQHGTLLGEKISSCSQYFEPPPLPHSTTLRSGKSAFSGYSSTRNAGSRAALIQECSSSSSGSGGKRTMLRTSSSNCSDDD
NYATLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPELAVEGEKMLYLAVSDTLTDQPHLKPIESALSP
VIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFG
WCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVFGPTEMSAYRRPFELRVYCVPETGAAMESVWKQEDGSRLLCESNDFI
LNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVSNE
PELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASS
SGSARAVPDLLQTLRVMGRPDAVMVLERFLSAFPQIVSP
Estimated Isoelectric Point:
6.00969696044922
Estimated Molecular Weight:
101.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr46
Lys41
Gln36
Leu73
Gly58
Met22
Ser101
Tyr27
His23
Glu52
Arg56
Cys34
Phe28
Pro52
Val63
Asn31
Ala64
Ile40
Trp14
Asp58