Sequence:
download
CE16723sequence.fasta
>SCL-20 MRFLPILFLIFPNCLCDFRFGPTAQREIVDFHNSLRSQLANGDYVVDGVPKPPAKDMMKMKWDPILAGMAKNNAATCPSL FTDSKMLGRNYYHRLANVTSGSLDKYALFAVKKWERQFQERGWKNQEFRMFGDHRLLTSATQMVWATTRHVGCGVNICDA EKNLFGYRNKVVVICEYQSKGNIHGLPIYKEGPTCSACPASTKCERRSGLCF
view sequence (212 aa)
>SCL-20
MRFLPILFLIFPNCLCDFRFGPTAQREIVDFHNSLRSQLANGDYVVDGVPKPPAKDMMKMKWDPILAGMAKNNAATCPSL
FTDSKMLGRNYYHRLANVTSGSLDKYALFAVKKWERQFQERGWKNQEFRMFGDHRLLTSATQMVWATTRHVGCGVNICDA
EKNLFGYRNKVVVICEYQSKGNIHGLPIYKEGPTCSACPASTKCERRSGLCF
Estimated Isoelectric Point:
9.27182769775391
Estimated Molecular Weight:
24.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys15
Gln7
Leu17
Gly15
Met8
Ser11
Tyr7
His5
Glu8
Arg14
Cys10
Phe13
Pro11
Val12
Asn12
Ala15
Ile8
Trp4
Asp10