Sequence:
download
CE16631sequence.fasta
>KLP-19 MSSDASLRVVVRARPMNGRETKEGASRCVQFYENTKQIVINESATFTFDAVFADTSDQESVYETTALPLLDRIFAGFNAT VLAYGQTGSGKTYTMGTEDNVGTDEMRRGIIPRLVSALFQRIMNTEAPESFAVTVSMFEVYGDNVYDLLRPDKVKLNVHG DEKNCTVVNLTAVPVIDLKGALKQLAVGCHYRTKAETAMNAMSSRSHAVFTVFVEKTATAECDSAFSAKLQLVDLAGSER LKKTEAEGNRMKEGININGGLLILSQVIAALATKQKHIPYRNSVITRVLQDSLGGNSFTVFLACISPADSNSQETLNTLR YADRAKQIKNKPIVNKNPKAEEIAILQAQLKRLQKENADLKQGIAPAEVRFNDANNSAEILSLKEEVVRKTEQLKERAMK QSECIIRMSALTQKNSRLEEDKAKLQSMLTDVRNTVLNEEMLDAAEVVRSIQQVVGDTEESTTLADDDNDETALGGQDDT IYDTERLPELQAELDDLEKQIAMKDENRQKALDEQRAFIEAMQQRESEKTQLVVRISELETEMNKLRQEGKKVTTAAKLA EERRQKLKDLERQHAEDKKVLNDMKKLQETRRRMEETLKKTEDELKNLKTQRLRLLREQRAEASKFQAFKQKHEREMAQM KSKLQKRENDVAIQKRMTDQKLTVLQMRLTEANRANKTLRELNLKRANRKSSPTNASALQNMIEEELEHEMCAQRSHWLC EDLRRQRHDLMQNINTVESMKFEGGKRRRISASADPNVSVVIEGEEEFEVKRQKELTFLRASLETLNEEIKDSLRNETIA GNEERANSRWEKVPAEMRPAFEAVYAQAVAHIRKEIELEFKLARTKSEFTAKIASKASHEEKRKKEDEEMRAKYRELAQC LEDAKSGLHEKIAFLLCLIKENRVDENAIQQFESLKNQFCDVEQKVKKASRRKTTNFMGGLTPKPELQRNERARRAVKYY GNVVNSEDVTMDDSRHQKRKDHSLLAVEMNRTTDDNVKRRVAMSPIKCDDDTRLTEEDEDIENEAMNNATFVKDSFNSAT IVLDDSQPSPSNSTFVIGAAPTSEADGVPPIKRKSRRTDLGPL
view sequence (1083 aa)
>KLP-19
MSSDASLRVVVRARPMNGRETKEGASRCVQFYENTKQIVINESATFTFDAVFADTSDQESVYETTALPLLDRIFAGFNAT
VLAYGQTGSGKTYTMGTEDNVGTDEMRRGIIPRLVSALFQRIMNTEAPESFAVTVSMFEVYGDNVYDLLRPDKVKLNVHG
DEKNCTVVNLTAVPVIDLKGALKQLAVGCHYRTKAETAMNAMSSRSHAVFTVFVEKTATAECDSAFSAKLQLVDLAGSER
LKKTEAEGNRMKEGININGGLLILSQVIAALATKQKHIPYRNSVITRVLQDSLGGNSFTVFLACISPADSNSQETLNTLR
YADRAKQIKNKPIVNKNPKAEEIAILQAQLKRLQKENADLKQGIAPAEVRFNDANNSAEILSLKEEVVRKTEQLKERAMK
QSECIIRMSALTQKNSRLEEDKAKLQSMLTDVRNTVLNEEMLDAAEVVRSIQQVVGDTEESTTLADDDNDETALGGQDDT
IYDTERLPELQAELDDLEKQIAMKDENRQKALDEQRAFIEAMQQRESEKTQLVVRISELETEMNKLRQEGKKVTTAAKLA
EERRQKLKDLERQHAEDKKVLNDMKKLQETRRRMEETLKKTEDELKNLKTQRLRLLREQRAEASKFQAFKQKHEREMAQM
KSKLQKRENDVAIQKRMTDQKLTVLQMRLTEANRANKTLRELNLKRANRKSSPTNASALQNMIEEELEHEMCAQRSHWLC
EDLRRQRHDLMQNINTVESMKFEGGKRRRISASADPNVSVVIEGEEEFEVKRQKELTFLRASLETLNEEIKDSLRNETIA
GNEERANSRWEKVPAEMRPAFEAVYAQAVAHIRKEIELEFKLARTKSEFTAKIASKASHEEKRKKEDEEMRAKYRELAQC
LEDAKSGLHEKIAFLLCLIKENRVDENAIQQFESLKNQFCDVEQKVKKASRRKTTNFMGGLTPKPELQRNERARRAVKYY
GNVVNSEDVTMDDSRHQKRKDHSLLAVEMNRTTDDNVKRRVAMSPIKCDDDTRLTEEDEDIENEAMNNATFVKDSFNSAT
IVLDDSQPSPSNSTFVIGAAPTSEADGVPPIKRKSRRTDLGPL
Estimated Isoelectric Point:
6.64255523681641
Estimated Molecular Weight:
123.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr70
Lys92
Gln57
Leu95
Gly36
Met33
Ser65
Tyr14
His14
Glu116
Arg85
Cys12
Phe31
Pro25
Val67
Asn61
Ala99
Ile45
Trp2
Asp64