Sequence:
download
CE16043sequence.fasta
>SEL-1 MIKTYLTLLLLATSATCQKKSATLVSAEGEAPAIKVIKTTGSLLTAIDVSKADLDWEQVTSQQDENKSNREIPKVISEEY LAEKVEQPPSPEAEAEFQRGMAYIERGKGHGREGRVAAHRVFERAAAQGHQEARKAVAFSQMFGDYSRWSIQEAKTVFED LEKNGSPDAQLALGFMHGAGIGVEKSNQAKALVYYMFSALGGNPLAQMAMGFRYSHGVGVPQNCETALSYYQKVAKTVVD NVKFTTGQTIQRLRLTDETDPTIHMQPGSAPLESNLLEYYKMLADKGDTSAQLGLGQIYLAGGRGLNQNFELAFRYLLAA AESGSADALTYLGKMYLDGTPFTPKDYQKSFEYLMKSADKSSPSAQAVLGAMYMKGKGVKKNYEKALKLLTLSADKKNAD GQMYLAELHYKGVPTNKGVHRDFKKSVKLYQLASQNGHILAYYNLAQMHAAGTGVPRSCSHAVDLFKSVAERGKWGERLM EAHSAYKDNRVDEAAMKYLFMAELGYEVAQTNLAYILDRGEATSLFSGPKDNNMERAFLNWQRSANQEYAAARVKLGDYY YYGLGTEVDHSLAFSNYKMAVDRHGVAQAMFNLGYMHEVGEGITRDLYLAKRFYDQAIEHSQDAYMPSKLALAKLAFVFY LEELNKLPLISFMEKTVGPRWDAILMTVSALVPLFLFWRHRQNDN
view sequence (685 aa)
>SEL-1
MIKTYLTLLLLATSATCQKKSATLVSAEGEAPAIKVIKTTGSLLTAIDVSKADLDWEQVTSQQDENKSNREIPKVISEEY
LAEKVEQPPSPEAEAEFQRGMAYIERGKGHGREGRVAAHRVFERAAAQGHQEARKAVAFSQMFGDYSRWSIQEAKTVFED
LEKNGSPDAQLALGFMHGAGIGVEKSNQAKALVYYMFSALGGNPLAQMAMGFRYSHGVGVPQNCETALSYYQKVAKTVVD
NVKFTTGQTIQRLRLTDETDPTIHMQPGSAPLESNLLEYYKMLADKGDTSAQLGLGQIYLAGGRGLNQNFELAFRYLLAA
AESGSADALTYLGKMYLDGTPFTPKDYQKSFEYLMKSADKSSPSAQAVLGAMYMKGKGVKKNYEKALKLLTLSADKKNAD
GQMYLAELHYKGVPTNKGVHRDFKKSVKLYQLASQNGHILAYYNLAQMHAAGTGVPRSCSHAVDLFKSVAERGKWGERLM
EAHSAYKDNRVDEAAMKYLFMAELGYEVAQTNLAYILDRGEATSLFSGPKDNNMERAFLNWQRSANQEYAAARVKLGDYY
YYGLGTEVDHSLAFSNYKMAVDRHGVAQAMFNLGYMHEVGEGITRDLYLAKRFYDQAIEHSQDAYMPSKLALAKLAFVFY
LEELNKLPLISFMEKTVGPRWDAILMTVSALVPLFLFWRHRQNDN
Estimated Isoelectric Point:
8.03409576416016
Estimated Molecular Weight:
76.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys50
Gln34
Leu70
Gly52
Met25
Ser43
Tyr39
His17
Glu45
Arg29
Cys3
Phe26
Pro21
Val37
Asn26
Ala81
Ile18
Trp6
Asp32