Sequence:
download
CE16012sequence.fasta
>RPS-26 MTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIH SKVVRNRSREARRDRNPPPRFGQRAAAARPGAPGPRP
view sequence (117 aa)
>RPS-26
MTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIH
SKVVRNRSREARRDRNPPPRFGQRAAAARPGAPGPRP
Estimated Isoelectric Point:
11.1100540161133
Estimated Molecular Weight:
13.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr3
Lys10
Gln2
Leu3
Gly7
Met1
Ser3
Tyr4
His5
Glu2
Arg18
Cys6
Phe4
Pro9
Val7
Asn7
Ala16
Ile6
Asp4