Sequence:
download
CE15961sequence.fasta
>CDR-1 MLDSCLIITAALFGAAVIYLKNFFTVPSIKPKPDIHKKDYKKDVVYLYQMKRLKNCPNLSPFCMKIEILCRIFKIPYEII TCTSERSRNGLVPFVELNGEHIADSDLIEMRLRSHFKIPSLPTELETQSVALSKFADHHLFFVLIRFKIAVDEFYKTIIE IIGLPTFLNFLLMPLLKAIIGKNVYNKCQGAIGDFELSELDEILHRDLRIVENTLAKKKFLFGEEITAADATVFSQLATV YYPFRNHISDVLEKDFPKLLEYCERVRHEVYPKDFTM
view sequence (277 aa)
>CDR-1
MLDSCLIITAALFGAAVIYLKNFFTVPSIKPKPDIHKKDYKKDVVYLYQMKRLKNCPNLSPFCMKIEILCRIFKIPYEII
TCTSERSRNGLVPFVELNGEHIADSDLIEMRLRSHFKIPSLPTELETQSVALSKFADHHLFFVLIRFKIAVDEFYKTIIE
IIGLPTFLNFLLMPLLKAIIGKNVYNKCQGAIGDFELSELDEILHRDLRIVENTLAKKKFLFGEEITAADATVFSQLATV
YYPFRNHISDVLEKDFPKLLEYCERVRHEVYPKDFTM
Estimated Isoelectric Point:
7.59958648681641
Estimated Molecular Weight:
32.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys24
Gln4
Leu33
Gly8
Met6
Ser13
Tyr11
His8
Glu20
Arg12
Cys7
Phe21
Pro14
Val16
Asn10
Ala15
Ile27
Asp15