Sequence:
download
CE15854sequence.fasta
>TIMM-23 MGWFGFGGNPTDTPSSSAEVSAAPIDLSAGMNFSVPGFDAPAPEPSVPDHSPFPAAPVLALDQLKSAGVGVSRQMTPYVQ MDPSMFASQQPQYIMPEGGVAGKGKFEFALGHIGWAVGGAFGVGCARGALGELMNPETRKMVGKPWMTRMVNATMKHGSG FAQPSGAIVFMYSALEIGLRSVRAEDELNGFGAGALTGAIYRSPHGLKASGVGALVGLGIAAAWTLSSTDSRQRLSEMFS NH
view sequence (242 aa)
>TIMM-23
MGWFGFGGNPTDTPSSSAEVSAAPIDLSAGMNFSVPGFDAPAPEPSVPDHSPFPAAPVLALDQLKSAGVGVSRQMTPYVQ
MDPSMFASQQPQYIMPEGGVAGKGKFEFALGHIGWAVGGAFGVGCARGALGELMNPETRKMVGKPWMTRMVNATMKHGSG
FAQPSGAIVFMYSALEIGLRSVRAEDELNGFGAGALTGAIYRSPHGLKASGVGALVGLGIAAAWTLSSTDSRQRLSEMFS
NH
Estimated Isoelectric Point:
6.19234466552734
Estimated Molecular Weight:
25.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys7
Gln8
Leu16
Gly34
Met13
Ser23
Tyr4
His5
Glu10
Arg9
Cys1
Phe13
Pro19
Val16
Asn6
Ala30
Ile7
Trp4
Asp8