Sequence:
download
CE15742sequence.fasta
>SMU-1 MSSIEIESSDVIRLIEQFLKESNLHRTLAILQEETNVSLNTVDSIDGFCNEITSGNWDNVLKTVQSLKLPAKKLIDLYEH VIIELVELRELATARLVARQTDPMILLKQIDPDRFARLESLINRPYFDGQEVYGDVSKEKRRSVIAQTLSSEVHVVAPSR LLSLLGQSLKWQLHQGLLPPGTAIDLFRGKAAQKEQIEERYPTMMARSIKFSTKSYPESAVFSPDANYLVSGSKDGFIEV WNYMNGKLRKDLKYQAQDNLMMMDAAVRCISFSRDSEMLATGSIDGKIKVWKVETGDCLRRFDRAHTKGVCAVRFSKDNS HILSGGNDHVVRVHGMKSGKCLKEMRGHSSYITDVRYSDEGNHIISCSTDGSIRVWHGKSGECLSTFRVGSEDYPILNVI PIPKSDPPQMIVCNRSNTLYVVNISGQVVRTMTSGKREKGDFINCILSPKGEWAYAIAEDGVMYCFMVLSGTLETTLPVT ERLPIGLAHHPHQNLIASYAEDGLLKLWTD
view sequence (510 aa)
>SMU-1
MSSIEIESSDVIRLIEQFLKESNLHRTLAILQEETNVSLNTVDSIDGFCNEITSGNWDNVLKTVQSLKLPAKKLIDLYEH
VIIELVELRELATARLVARQTDPMILLKQIDPDRFARLESLINRPYFDGQEVYGDVSKEKRRSVIAQTLSSEVHVVAPSR
LLSLLGQSLKWQLHQGLLPPGTAIDLFRGKAAQKEQIEERYPTMMARSIKFSTKSYPESAVFSPDANYLVSGSKDGFIEV
WNYMNGKLRKDLKYQAQDNLMMMDAAVRCISFSRDSEMLATGSIDGKIKVWKVETGDCLRRFDRAHTKGVCAVRFSKDNS
HILSGGNDHVVRVHGMKSGKCLKEMRGHSSYITDVRYSDEGNHIISCSTDGSIRVWHGKSGECLSTFRVGSEDYPILNVI
PIPKSDPPQMIVCNRSNTLYVVNISGQVVRTMTSGKREKGDFINCILSPKGEWAYAIAEDGVMYCFMVLSGTLETTLPVT
ERLPIGLAHHPHQNLIASYAEDGLLKLWTD
Estimated Isoelectric Point:
6.71497344970703
Estimated Molecular Weight:
57.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys31
Gln17
Leu50
Gly33
Met15
Ser48
Tyr15
His14
Glu32
Arg30
Cys10
Phe14
Pro19
Val37
Asn20
Ala26
Ile36
Trp7
Asp31