Sequence:
download
CE15592sequence.fasta
>MOG-4, isoform a MSVEQFINDQLHSIVGISDRSICQYVHALAKKAKSAPDLVEKLRDAGDFPISPAIQSFADQLMSRMPRQATSARQRGPTT AELAEQELNRLNRAVGVLEDYSASSTKTKNVRKRKESSSEDDEAPIKASKPGKSVKPSKSDDSESDIEAMEAKLDADIAE RDALAARINKKEKDKTRNVMEKKRDDNKDKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKA DMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEEEQLMASMLHLGAKDAKRKEQ EFELLLDEKVDFIQALQMPGTNEEVVETEAEKKKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQY LYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYS VMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAA IVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLAT NIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPE IQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKY ECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDV RDQLVGLLERVEIETKSSTDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPRWVVYFELVFTSK EFMREMSEIESGWLLEVAPHYYKGRELEDATNKKMPKNKGKSGKDLER
view sequence (1008 aa)
>MOG-4, isoform a
MSVEQFINDQLHSIVGISDRSICQYVHALAKKAKSAPDLVEKLRDAGDFPISPAIQSFADQLMSRMPRQATSARQRGPTT
AELAEQELNRLNRAVGVLEDYSASSTKTKNVRKRKESSSEDDEAPIKASKPGKSVKPSKSDDSESDIEAMEAKLDADIAE
RDALAARINKKEKDKTRNVMEKKRDDNKDKEGSSMDKLREESRRQYLKKRKVDKLEELEAIVHDDQTLFAREKLTKREKA
DMEYRKKVLEYTKAHGKAGDVMKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEEEQLMASMLHLGAKDAKRKEQ
EFELLLDEKVDFIQALQMPGTNEEVVETEAEKKKMSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQY
LYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTSEKTVLKYMTDGMLLREFLNEPDLASYS
VMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAPEADYVDAA
IVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLAT
NIAETSVTIDGINYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYKHELEEQPIPE
IQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKY
ECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESSFSQRWCVENYVQHRTMKRARDV
RDQLVGLLERVEIETKSSTDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFEETPRWVVYFELVFTSK
EFMREMSEIESGWLLEVAPHYYKGRELEDATNKKMPKNKGKSGKDLER
Estimated Isoelectric Point:
6.33376312255859
Estimated Molecular Weight:
114.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr53
Lys89
Gln38
Leu82
Gly50
Met30
Ser65
Tyr31
His25
Glu94
Arg62
Cys12
Phe35
Pro43
Val60
Asn26
Ala86
Ile54
Trp7
Asp66