Sequence:
download
CE15473sequence.fasta
>KIN-1, isoform a MLKFLKPKSSDEGSSKDNKNSASLKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAM KILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIV LAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM AAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIE APFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKEFAEF
view sequence (359 aa)
>KIN-1, isoform a
MLKFLKPKSSDEGSSKDNKNSASLKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAM
KILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIV
LAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEM
AAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIE
APFLPKCRGPGDASNFDDYEEEPLRISGTEKCAKEFAEF
Estimated Isoelectric Point:
8.93099212646484
Estimated Molecular Weight:
41.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys38
Gln11
Leu37
Gly22
Met7
Ser23
Tyr15
His7
Glu23
Arg15
Cys4
Phe25
Pro15
Val15
Asn17
Ala22
Ile21
Trp6
Asp23