Sequence:
download
CE15373sequence.fasta
>TRXR-2 MLLSTFKRHLPIRRLFSSNKFDLIVIGAGSGGLSCSKRAADLGANVALIDAVEPTPHGHSWGIGGTCANVGCIPKKLMHQ AAIVGKELKHADKYGWNGIDQEKIKHDWNVLSKNVNDRVKANNWIYRVQLNQKKINYFNAYAEFVDKDKIVITGTDKNKT KNFLSAPNVVISTGLRPKYPNIPGAELGITSDDLFTLASVPGKTLIVGGGYVALECAGFLSAFNQNVEVLVRSIPLKGFD RDCVHFVMEHLKTTGVKVKEHVEVERVEAVGSKKKVTFTGNGGVEEYDTVIWAAGRVPNLKSLNLDNAGVRTDKRSGKIL ADEFDRASCNGVYAVGDIVQDRQELTPLAIQSGKLLADRLFSNSKQIVRFDGVATTVFTPLELSTVGLTEEEAIQKHGED SIEVFHSHFTPFEYVVPQNKDSGFCYVKAVCTRDESQKILGLHFVGPNAAEVIQGYAVAFRVGISMSDLQNTIAIHPCSS EEFVKLHITKRSGQDPRTQGCCG
view sequence (503 aa)
>TRXR-2
MLLSTFKRHLPIRRLFSSNKFDLIVIGAGSGGLSCSKRAADLGANVALIDAVEPTPHGHSWGIGGTCANVGCIPKKLMHQ
AAIVGKELKHADKYGWNGIDQEKIKHDWNVLSKNVNDRVKANNWIYRVQLNQKKINYFNAYAEFVDKDKIVITGTDKNKT
KNFLSAPNVVISTGLRPKYPNIPGAELGITSDDLFTLASVPGKTLIVGGGYVALECAGFLSAFNQNVEVLVRSIPLKGFD
RDCVHFVMEHLKTTGVKVKEHVEVERVEAVGSKKKVTFTGNGGVEEYDTVIWAAGRVPNLKSLNLDNAGVRTDKRSGKIL
ADEFDRASCNGVYAVGDIVQDRQELTPLAIQSGKLLADRLFSNSKQIVRFDGVATTVFTPLELSTVGLTEEEAIQKHGED
SIEVFHSHFTPFEYVVPQNKDSGFCYVKAVCTRDESQKILGLHFVGPNAAEVIQGYAVAFRVGISMSDLQNTIAIHPCSS
EEFVKLHITKRSGQDPRTQGCCG
Estimated Isoelectric Point:
8.48740386962891
Estimated Molecular Weight:
55.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys39
Gln16
Leu39
Gly45
Met4
Ser31
Tyr11
His15
Glu27
Arg21
Cys11
Phe23
Pro18
Val49
Asn27
Ala36
Ile31
Trp5
Asp28