Sequence:
download
CE15159sequence.fasta
>GLD-2, isoform b MPSSIICDVSHEGEASGGPSPSSRISNGFSHTVCDLHHNFPIVKNRRKYHNSISTQSSSSTTTSLERISTSTCTSTSSSA SDAIISRAEKDVQTFLVSDESTTGDHEEEEEDDEDGDDESDHNDYDYEDDGERSEHDHEQTDNDDDEDEIEPFVSSWCFA MGTQRSVMSSVGEKAPKSNVKSMEDWELDVVERAHRESHLAELYADLSWRFYTHPPTSFCLARVFLRHGLTGNEGVSSWK LPRKANRRNSSCSSISSVSESSSPSALDESTLTKILPTDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYHNKVSQ TDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQYEKFVE SQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSYSL VLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDA ISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSASTSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPFTNSNT AHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECEPIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRVLNSIP VSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRGFNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNENVRDSS RQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
view sequence (871 aa)
>GLD-2, isoform b
MPSSIICDVSHEGEASGGPSPSSRISNGFSHTVCDLHHNFPIVKNRRKYHNSISTQSSSSTTTSLERISTSTCTSTSSSA
SDAIISRAEKDVQTFLVSDESTTGDHEEEEEDDEDGDDESDHNDYDYEDDGERSEHDHEQTDNDDDEDEIEPFVSSWCFA
MGTQRSVMSSVGEKAPKSNVKSMEDWELDVVERAHRESHLAELYADLSWRFYTHPPTSFCLARVFLRHGLTGNEGVSSWK
LPRKANRRNSSCSSISSVSESSSPSALDESTLTKILPTDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYHNKVSQ
TDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQYEKFVE
SQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSYSL
VLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLNVTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDA
ISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSASTSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPFTNSNT
AHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECEPIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRVLNSIP
VSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRGFNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNENVRDSS
RQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRKDDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
Estimated Isoelectric Point:
5.70720672607422
Estimated Molecular Weight:
96.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr49
Lys39
Gln37
Leu59
Gly44
Met17
Ser124
Tyr22
His29
Glu56
Arg50
Cys13
Phe27
Pro45
Val52
Asn62
Ala45
Ile36
Trp9
Asp56