Sequence:
download
CE15028sequence.fasta
>UNC-52, isoform a MKRSSTVLAALLALLLVATNDAARHRKYRQTYQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR WARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNE CVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQC HDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQ TSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTC ECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSF FKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSP VRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGY LGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIP CFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGD KVTSYGGTLEYTFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLAD LDTLLIKSTYNDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGH ASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCE RCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDI TFVQKPHEVLRVRIMEPKRQIALPGDRVHWICQVTGYTTEKIHVEWTKVGEMSLPPNAKAYDGYLVLKGVEAENAGQYRC TATTITQYATDDALLTISKRISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALK IPQSQLHHAGRYICSAANQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPS GVQEQQGILHIPRASDQEVGQYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQ PRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEG EPSRIRCWVPGHPNIQLQFVKRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPI IDPAEQTVPEGSPFKIRCYVPGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPAT VHVTNAAAPPQVEARPPQHPVITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQ DAGEYVCLYSPENSPPVKTNPSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVN QDGDDIVISEAGDRNVGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWT GPNGSPLPHDVTPLEPNILDFSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEA FGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVS ILGGSSQWFDQGEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAA VHVHSSANADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVY RCNVEDNNGLVIGSAFTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFD DASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQV TGGRLLFTDLKEDNAGVYRCVAKTKAGPLQTRTVLNVGSGKRKRKHLGNRRGRRLRHRRRNAQNGPLSRKTRTTTKLFGS WF
view sequence (2482 aa)
>UNC-52, isoform a
MKRSSTVLAALLALLLVATNDAARHRKYRQTYQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVR
WARVGGPLPSSAHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNE
CVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQC
HDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQ
TSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTC
ECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSF
FKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSP
VRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGY
LGTSCEDCAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIP
CFCSGVTQQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGD
KVTSYGGTLEYTFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLAD
LDTLLIKSTYNDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGH
ASQCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCE
RCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDI
TFVQKPHEVLRVRIMEPKRQIALPGDRVHWICQVTGYTTEKIHVEWTKVGEMSLPPNAKAYDGYLVLKGVEAENAGQYRC
TATTITQYATDDALLTISKRISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALK
IPQSQLHHAGRYICSAANQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPS
GVQEQQGILHIPRASDQEVGQYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQ
PRAQLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEG
EPSRIRCWVPGHPNIQLQFVKRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPI
IDPAEQTVPEGSPFKIRCYVPGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPAT
VHVTNAAAPPQVEARPPQHPVITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQ
DAGEYVCLYSPENSPPVKTNPSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVN
QDGDDIVISEAGDRNVGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWT
GPNGSPLPHDVTPLEPNILDFSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEA
FGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVS
ILGGSSQWFDQGEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAA
VHVHSSANADDEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVY
RCNVEDNNGLVIGSAFTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFD
DASAGTYVCKVSFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQV
TGGRLLFTDLKEDNAGVYRCVAKTKAGPLQTRTVLNVGSGKRKRKHLGNRRGRRLRHRRRNAQNGPLSRKTRTTTKLFGS
WF
Estimated Isoelectric Point:
5.28508758544922
Estimated Molecular Weight:
270.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr168
Lys92
Gln128
Leu149
Gly208
Met11
Ser158
Tyr70
His55
Glu150
Arg150
Cys107
Phe64
Pro217
Val180
Asn119
Ala163
Ile99
Trp28
Asp166