Sequence:
download
CE14902sequence.fasta
>MAB-3, isoform a MLTEDPVSEICEAKAVDELAEQEKNYYCQRCLNHGELKPRKGHKPDCRYLKCPCRECTMVEQRRQLNNLLSKKKIHCTPA TQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCECTLCTLVEHRRNLMAAQIKLRRSQQKSRDGKEPKRNSRRK SKDMDMEMMVVTATDGQKIIGTSASPSPSSTTDTMSPSLSMSPPCSPSPLLAQYTLTLAAPIPIYPPIPMNQQLISLQQQ QFLMSIIQNMAPSIGQQAPLLPGISAGSVSSAAILNEFWSMYLKNYGLQA
view sequence (290 aa)
>MAB-3, isoform a
MLTEDPVSEICEAKAVDELAEQEKNYYCQRCLNHGELKPRKGHKPDCRYLKCPCRECTMVEQRRQLNNLLSKKKIHCTPA
TQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCECTLCTLVEHRRNLMAAQIKLRRSQQKSRDGKEPKRNSRRK
SKDMDMEMMVVTATDGQKIIGTSASPSPSSTTDTMSPSLSMSPPCSPSPLLAQYTLTLAAPIPIYPPIPMNQQLISLQQQ
QFLMSIIQNMAPSIGQQAPLLPGISAGSVSSAAILNEFWSMYLKNYGLQA
Estimated Isoelectric Point:
9.27823638916016
Estimated Molecular Weight:
32.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys19
Gln21
Leu27
Gly12
Met14
Ser26
Tyr7
His7
Glu14
Arg20
Cys15
Phe3
Pro23
Val11
Asn10
Ala19
Ile14
Trp1
Asp10