Sequence:
download
CE14668sequence.fasta
>RET-1, isoform b MAQTRFVNKKYSKQPTWVPATDFPGKILDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFK KVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGF TLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEKLPFLRSAPVAAEEKKDQ
view sequence (222 aa)
>RET-1, isoform b
MAQTRFVNKKYSKQPTWVPATDFPGKILDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFK
KVEAQIKKTDSEHPFSEILAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGF
TLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEKLPFLRSAPVAAEEKKDQ
Estimated Isoelectric Point:
9.00971221923828
Estimated Molecular Weight:
24.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys21
Gln9
Leu30
Gly8
Met1
Ser15
Tyr6
His5
Glu12
Arg4
Cys1
Phe13
Pro11
Val21
Asn5
Ala23
Ile13
Trp4
Asp9