Sequence:
download
CE14434sequence.fasta
>UNC-37 MKASYLETLDRIKDEHAEMSKHVNQQRSDIEKVALEKENMNRSYMTYAEVSNTLRSDLRKAEEINKRLQEFIMQSLAPQL SQDNQANCLAALEAFKTASPRENGNGAPALPPGFPPGAAGMLGMMPNMPFGMSPAMSQLFNQFASPHVNGGDGAGGSSGG ASEAKKAKLEDPDDGELEIDVTNDDHPSTASNGGAANKNGRDSTNSVASSGASTPSIASNSRARQQQQPLAGLQGLEQMN FLAGFNPNLLRQASAAGGFNFLNDPHAQARLAAAIGQIGSRPAYSFKIVDGGVPTPTSFPPDAQKGPGIPTGLKKKMELN HGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATVVNRPPIASLDCLKENYIRSCKLFEDGNTLLIGGEASTVAL WDLTTETKTLDLETDSQACYALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDN SVRCWDLAQRKEVAKHDFASQVFSLGCCPNDEWVAVGMENNYVEVLSTTGKEKYQLTQHESCVLSLKFAHSGKFFISTGK DNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGSGEKKATLYAVEY
view sequence (612 aa)
>UNC-37
MKASYLETLDRIKDEHAEMSKHVNQQRSDIEKVALEKENMNRSYMTYAEVSNTLRSDLRKAEEINKRLQEFIMQSLAPQL
SQDNQANCLAALEAFKTASPRENGNGAPALPPGFPPGAAGMLGMMPNMPFGMSPAMSQLFNQFASPHVNGGDGAGGSSGG
ASEAKKAKLEDPDDGELEIDVTNDDHPSTASNGGAANKNGRDSTNSVASSGASTPSIASNSRARQQQQPLAGLQGLEQMN
FLAGFNPNLLRQASAAGGFNFLNDPHAQARLAAAIGQIGSRPAYSFKIVDGGVPTPTSFPPDAQKGPGIPTGLKKKMELN
HGEVVCAATISRDNSRVYTGGKGCVKIWDVKESDISGATVVNRPPIASLDCLKENYIRSCKLFEDGNTLLIGGEASTVAL
WDLTTETKTLDLETDSQACYALAMSPDEKLLFACLADGNILIYDIHNKVKVGTLPGHQDGASCLDLSKDGTKLWSGGLDN
SVRCWDLAQRKEVAKHDFASQVFSLGCCPNDEWVAVGMENNYVEVLSTTGKEKYQLTQHESCVLSLKFAHSGKFFISTGK
DNALNAWRTPYGASLFQLKENSSVLSCDISFDDSLIVTGSGEKKATLYAVEY
Estimated Isoelectric Point:
5.32695770263672
Estimated Molecular Weight:
65.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys38
Gln26
Leu56
Gly54
Met15
Ser56
Tyr13
His11
Glu35
Arg20
Cys13
Phe21
Pro30
Val29
Asn37
Ala62
Ile22
Trp6
Asp38