Sequence:
download
CE14114sequence.fasta
>RAB-10 MARRPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYR GAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVD TAFYDLAEAILAKMPDSTDEQSRDTVNPVQPQRQSSSGGCC
view sequence (201 aa)
>RAB-10
MARRPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYR
GAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVD
TAFYDLAEAILAKMPDSTDEQSRDTVNPVQPQRQSSSGGCC
Estimated Isoelectric Point:
6.95540618896484
Estimated Molecular Weight:
22.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys15
Gln7
Leu13
Gly13
Met7
Ser15
Tyr6
His5
Glu9
Arg12
Cys4
Phe9
Pro4
Val10
Asn7
Ala13
Ile18
Trp2
Asp18