Sequence:
download
CE14096sequence.fasta
>GLD-1 MPSCTTPTYGVSTQLESQSSESPSRSSVMTPTSLDGDNSPRKRFPIIDNVPADRWPSTRRDGWSSVRAPPPARLTLSTNN RHIMSPISSAYSQTPNSLLSPAMFNPKSRSIFSPTLPATPMSYGKSSMDKSLFSPTATEPIEVEATVEYLADLVKEKKHL TLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDT GCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMEL AIINGTYRPMKSPNPARVMTAVPLLSPTPLRSSGPVLMSPTPGSGLPSTTFGGSILSPTLTASNLLGSNVFDYSLLSPSM FDSFSSLQLASDLTFPKYPTTTSFVNSFPGLFTSASSFANQTNTNVSPSGASPSASSVNNTSF
view sequence (463 aa)
>GLD-1
MPSCTTPTYGVSTQLESQSSESPSRSSVMTPTSLDGDNSPRKRFPIIDNVPADRWPSTRRDGWSSVRAPPPARLTLSTNN
RHIMSPISSAYSQTPNSLLSPAMFNPKSRSIFSPTLPATPMSYGKSSMDKSLFSPTATEPIEVEATVEYLADLVKEKKHL
TLFPHMFSNVERLLDDEIGRVRVALFQTEFPRVELPEPAGDMISITEKIYVPKNEYPDYNFVGRILGPRGMTAKQLEQDT
GCKIMVRGKGSMRDKSKESAHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLIPAPEGTDELKRKQLMEL
AIINGTYRPMKSPNPARVMTAVPLLSPTPLRSSGPVLMSPTPGSGLPSTTFGGSILSPTLTASNLLGSNVFDYSLLSPSM
FDSFSSLQLASDLTFPKYPTTTSFVNSFPGLFTSASSFANQTNTNVSPSGASPSASSVNNTSF
Estimated Isoelectric Point:
8.28253936767578
Estimated Molecular Weight:
50.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr38
Lys22
Gln12
Leu43
Gly23
Met16
Ser64
Tyr10
His7
Glu24
Arg24
Cys3
Phe19
Pro46
Val25
Asn21
Ala26
Ile17
Trp3
Asp20