Sequence:
download
CE13968sequence.fasta
>RPL-11.1, isoform a MTDVEKQTEIREKKGRNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRTFGIRRNEKIAVHCT VRGPKAEEILEKGLKVKEYELFKENFSDTGNFGFGVQEHIDLGIKYDPGIGIYGMDFYVVLNRNGVRVSKRRRAPGRIGP SHRVDKEETIKWFQQKYDGIILPPKPKVKKNFFRRR
view sequence (196 aa)
>RPL-11.1, isoform a
MTDVEKQTEIREKKGRNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRTFGIRRNEKIAVHCT
VRGPKAEEILEKGLKVKEYELFKENFSDTGNFGFGVQEHIDLGIKYDPGIGIYGMDFYVVLNRNGVRVSKRRRAPGRIGP
SHRVDKEETIKWFQQKYDGIILPPKPKVKKNFFRRR
Estimated Isoelectric Point:
10.0044479370117
Estimated Molecular Weight:
22.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys22
Gln7
Leu12
Gly18
Met3
Ser5
Tyr6
His3
Glu16
Arg20
Cys3
Phe10
Pro8
Val16
Asn8
Ala6
Ile14
Trp1
Asp8