Sequence:
download
CE13934sequence.fasta
>SUP-12, isoform a MYGQVQDPLVHAAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGF VTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFQPRMGLPQMYYPTVTGLV NPLMAQQGAAAQQQLFDYNALAAVMNPQAAAAYGIQSQGKFAAAPTTIEQYAAYPAGYGLVPQSAYNIGNPQLQQLAAAQ QQLEHQRV
view sequence (248 aa)
>SUP-12, isoform a
MYGQVQDPLVHAAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGF
VTMKDRASAERACKDPNPIIDGRKANVNLAYLGAKPRTNVQLAALAAGQVQLPLTTQLQALFQPRMGLPQMYYPTVTGLV
NPLMAQQGAAAQQQLFDYNALAAVMNPQAAAAYGIQSQGKFAAAPTTIEQYAAYPAGYGLVPQSAYNIGNPQLQQLAAAQ
QQLEHQRV
Estimated Isoelectric Point:
6.90210723876953
Estimated Molecular Weight:
26.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys8
Gln29
Leu21
Gly18
Met7
Ser7
Tyr13
His4
Glu8
Arg9
Cys1
Phe8
Pro16
Val16
Asn11
Ala40
Ile8
Asp9