Sequence:
download
CE13451sequence.fasta
>UNC-29 MRTNRLSWILVLSVVIFLVIINTINASDDEERLMVDVFRGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTN VWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVE FFPFDEQVCTLVFGSWTYNENEIKLEFVQAELVDVSEYSASSIWDVIDVPASLVNKRSRIEFQVRIRRKTLFYTVVLIIP TVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFR GPRTHRMPQWVRVVFLQFLPKLVCMKRPKSASERSAVRSGMAQLPGVGQFTLSPSAHHPLCPSADDRTTTIRNTASNETS AYYPLSTDALRAIDAIEYITEHLKRDEQHKSFRDDWKYVAMIIDRLLLYVFFGITVGGTCGILFSAPHVFQRIDQQEMLD RLKEKYDTASNIP
view sequence (493 aa)
>UNC-29
MRTNRLSWILVLSVVIFLVIINTINASDDEERLMVDVFRGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTN
VWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVE
FFPFDEQVCTLVFGSWTYNENEIKLEFVQAELVDVSEYSASSIWDVIDVPASLVNKRSRIEFQVRIRRKTLFYTVVLIIP
TVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFR
GPRTHRMPQWVRVVFLQFLPKLVCMKRPKSASERSAVRSGMAQLPGVGQFTLSPSAHHPLCPSADDRTTTIRNTASNETS
AYYPLSTDALRAIDAIEYITEHLKRDEQHKSFRDDWKYVAMIIDRLLLYVFFGITVGGTCGILFSAPHVFQRIDQQEMLD
RLKEKYDTASNIP
Estimated Isoelectric Point:
6.52249908447266
Estimated Molecular Weight:
56.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys21
Gln17
Leu54
Gly14
Met15
Ser37
Tyr15
His9
Glu22
Arg26
Cys6
Phe26
Pro25
Val53
Asn22
Ala23
Ile42
Trp10
Asp27