Sequence:
download
CE13333sequence.fasta
>SRA-23 MNKTAEELLDSLKCASDGLASALTSVTLKFNCAFISTIVLISYCFSWLAIQALWNNNIFSNSTRLILIVCLLNSVVHQTT VMETRITQIYRSIVFASEPCEILFRSSECEIELYFYYLTNYFSTYSVFSLTFDRLISHYKSKYYHMHQYFIAISLLVLQF LLAILSFYIAYHGVPLAGYVPMCNYYPKMAVHHITINDVRTVVMVSCIIVTGFAYYLSVKSEKQIQKCSYSPGERYSAYE NVTTSQSVCILIVLQFSCTMISSFGVNLLLMMQEAVSEETFTKVGAFLPGVAYANLCLPLAIYFKTKLTIQNRKLRIAVM ISMYGDVGEHIARLKKSWEY
view sequence (340 aa)
>SRA-23
MNKTAEELLDSLKCASDGLASALTSVTLKFNCAFISTIVLISYCFSWLAIQALWNNNIFSNSTRLILIVCLLNSVVHQTT
VMETRITQIYRSIVFASEPCEILFRSSECEIELYFYYLTNYFSTYSVFSLTFDRLISHYKSKYYHMHQYFIAISLLVLQF
LLAILSFYIAYHGVPLAGYVPMCNYYPKMAVHHITINDVRTVVMVSCIIVTGFAYYLSVKSEKQIQKCSYSPGERYSAYE
NVTTSQSVCILIVLQFSCTMISSFGVNLLLMMQEAVSEETFTKVGAFLPGVAYANLCLPLAIYFKTKLTIQNRKLRIAVM
ISMYGDVGEHIARLKKSWEY
Estimated Isoelectric Point:
8.35089874267578
Estimated Molecular Weight:
38.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys15
Gln11
Leu38
Gly10
Met11
Ser35
Tyr25
His8
Glu16
Arg10
Cys12
Phe19
Pro7
Val27
Asn14
Ala22
Ile30
Trp3
Asp5