Sequence:
download
CE13112sequence.fasta
>HCP-4 MNRKPRTRSTIVPGRKMITEIVALREAGLDDTRPSYLEEPTVIVDESMMNDSANLEEREWRKQGLSEKQMFAILEKRKQT QLNNARKRLEKEMYGAKTFKELIACREYSECESDSENTVNQNVRSASVFAIPALPKHISEKSMMGSPIANSRGSGKAGLS CSTPKSSSDTSMRSLRSLDISHVVNTDRLDAERVTVHTKSVVIPTILEERESTLQKTLTIEKNHSSQLQKTFTVAEDAPE ELQKTVTIEKNQSSEMQRTFTVAKDASKEQSQLQRTVTIEKNQSSQLQGNFTVAKDAPEELQKTVTIEKNQSSEMQGTVT VAKDAEHSSLQKTFTKPTEKDESSLQRTFNVANRDENNDSTLQKTFIIEERDAYEQGTTSVGVKPPVLAQNTMEGGEKRR TSKVTSDERERRNASISNPLHNSMLEKEEIQSPGANFFKHPRKKIRPVVQTPPRIKATSRLSTESNKERTIEMESVAEER TMEADSIGSSYISPTFNASRVSPVPEVPEKVEPMHVSKAATPKSIRHTDNSIRNIGPTNNVECARAALLSTPTRMDIVDS VNRVTPARRYEQPTFASLVKRMNMKDANRLLEETSRKNTPAKTTATTSSAAVRMVLEDDEEDQATEVIEKRSENGGVIVD GEDEAADSSNRSLNIELNALTVNEEPAHDISAIDFPEDDTNEMRSSSDEEEMEARPDPRKKSSRRLGLLSDSIALGLASS SRRRPNDTFVDETWYPEPNSKGNRRPRTHRGMKLKEHQLMKPEDAPDGVRRSTRVRVKPVRSWLGEQPVYVNSPISGCKR LTGVTAVVIKDPRLCYYRTADVRTATERELKDKANKRALAQEKKQQRQNARSGRRHDSDDDEEDDM
view sequence (866 aa)
>HCP-4
MNRKPRTRSTIVPGRKMITEIVALREAGLDDTRPSYLEEPTVIVDESMMNDSANLEEREWRKQGLSEKQMFAILEKRKQT
QLNNARKRLEKEMYGAKTFKELIACREYSECESDSENTVNQNVRSASVFAIPALPKHISEKSMMGSPIANSRGSGKAGLS
CSTPKSSSDTSMRSLRSLDISHVVNTDRLDAERVTVHTKSVVIPTILEERESTLQKTLTIEKNHSSQLQKTFTVAEDAPE
ELQKTVTIEKNQSSEMQRTFTVAKDASKEQSQLQRTVTIEKNQSSQLQGNFTVAKDAPEELQKTVTIEKNQSSEMQGTVT
VAKDAEHSSLQKTFTKPTEKDESSLQRTFNVANRDENNDSTLQKTFIIEERDAYEQGTTSVGVKPPVLAQNTMEGGEKRR
TSKVTSDERERRNASISNPLHNSMLEKEEIQSPGANFFKHPRKKIRPVVQTPPRIKATSRLSTESNKERTIEMESVAEER
TMEADSIGSSYISPTFNASRVSPVPEVPEKVEPMHVSKAATPKSIRHTDNSIRNIGPTNNVECARAALLSTPTRMDIVDS
VNRVTPARRYEQPTFASLVKRMNMKDANRLLEETSRKNTPAKTTATTSSAAVRMVLEDDEEDQATEVIEKRSENGGVIVD
GEDEAADSSNRSLNIELNALTVNEEPAHDISAIDFPEDDTNEMRSSSDEEEMEARPDPRKKSSRRLGLLSDSIALGLASS
SRRRPNDTFVDETWYPEPNSKGNRRPRTHRGMKLKEHQLMKPEDAPDGVRRSTRVRVKPVRSWLGEQPVYVNSPISGCKR
LTGVTAVVIKDPRLCYYRTADVRTATERELKDKANKRALAQEKKQQRQNARSGRRHDSDDDEEDDM
Estimated Isoelectric Point:
7.23653411865234
Estimated Molecular Weight:
97.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr72
Lys62
Gln35
Leu50
Gly29
Met25
Ser89
Tyr10
His13
Glu89
Arg76
Cys6
Phe15
Pro45
Val56
Asn46
Ala59
Ile37
Trp3
Asp49